KEGG   Streptomyces galilaeus: CP966_29130
Entry
CP966_29130       CDS       T06932                                 

Definition
(GenBank) ester cyclase
  KO
K15945  C-1 hydroxylase
Organism
sgal  Streptomyces galilaeus
Pathway
sgal01057  Biosynthesis of type II polyketide products
sgal01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sgal00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01057 Biosynthesis of type II polyketide products
    CP966_29130
SSDB
Motif
Pfam: SnoaL SnoaL_2 DUF4440
Other DBs
NCBI-ProteinID: QEU68881
UniProt: A0A5J6EYN2
Position
6365381..6365818
AA seq 145 aa
MSMAERKAQCLEMVAAWNRWDLSGIIKHWSPDIVHYSEDNEVSSADMVKLMEGGLKAFPD
LQLEVKSIMAEEDRVALRITVTATHQGEFMGVQPTGQRVSWHLVEELRFADGKVVEHWDV
INMRPLLVRLGKLPDVPKVALEASV
NT seq 438 nt   +upstreamnt  +downstreamnt
atgtcaatggccgagcgcaaggcgcagtgtctggaaatggtcgccgcctggaaccggtgg
gacctgagcgggatcatcaagcactggtcgccggacatcgtgcactactccgaggacaac
gaggtgagttccgccgacatggtgaagctcatggagggcgggctgaaggcgttccccgat
ctccagctcgaagtgaagagcatcatggccgaggaggaccgggtcgcgctgcggatcacc
gtgaccgccacccaccagggcgagttcatgggcgtacagcccaccggacagcgggtcagc
tggcacctggtggaggaactgcgcttcgccgacggcaaggtcgtggagcactgggacgtc
atcaacatgcgccccctcctggtccgcctcggcaagctgccggacgtcccgaaggtcgcc
ctggaggcgagcgtctga

DBGET integrated database retrieval system