KEGG   Streptococcus agalactiae GD201008-001 (serotype Ia): A964_0496Help
Entry
A964_0496         CDS       T02248                                 

Gene name
atoB
Definition
(GenBank) thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sgc  Streptococcus agalactiae GD201008-001 (serotype Ia)
Pathway
sgc00071  Fatty acid degradation
sgc00072  Synthesis and degradation of ketone bodies
sgc00280  Valine, leucine and isoleucine degradation
sgc00310  Lysine degradation
sgc00362  Benzoate degradation
sgc00380  Tryptophan metabolism
sgc00620  Pyruvate metabolism
sgc00630  Glyoxylate and dicarboxylate metabolism
sgc00640  Propanoate metabolism
sgc00650  Butanoate metabolism
sgc00900  Terpenoid backbone biosynthesis
sgc01100  Metabolic pathways
sgc01110  Biosynthesis of secondary metabolites
sgc01120  Microbial metabolism in diverse environments
sgc01130  Biosynthesis of antibiotics
sgc01200  Carbon metabolism
sgc01212  Fatty acid metabolism
sgc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sgc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    A964_0496 (atoB)
   00630 Glyoxylate and dicarboxylate metabolism
    A964_0496 (atoB)
   00640 Propanoate metabolism
    A964_0496 (atoB)
   00650 Butanoate metabolism
    A964_0496 (atoB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    A964_0496 (atoB)
   00072 Synthesis and degradation of ketone bodies
    A964_0496 (atoB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A964_0496 (atoB)
   00310 Lysine degradation
    A964_0496 (atoB)
   00380 Tryptophan metabolism
    A964_0496 (atoB)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    A964_0496 (atoB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    A964_0496 (atoB)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    A964_0496 (atoB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sgc04147]
    A964_0496 (atoB)
Enzymes [BR:sgc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     A964_0496 (atoB)
Exosome [BR:sgc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A964_0496 (atoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C
Motif
Other DBs
NCBI-ProteinID: AFS45285
Position
510640..511755
Genome map
AA seq 371 aa AA seqDB search
MKNRDVYIGFGLRTPIGIKGKQFKHYRPELLGAHLLNQIKKIESESNIDSIICGNTVGTG
GNIGRLMTLFSDYESYIPVQTIDMQCASSSSALFFGYLKISTGINEKVLVGGIESSSLQP
MRRYAKEDNRNGEYTVAQFSPDSYAETVMLEGAQRVCQKYGFRREMLDKLAFLSHKRALT
AKQGGYLEEVILPMEGMRDQGVRKLKETFFQKLPRLMENSPLLTIGNVCLMHDAAAFLTL
QSQKTEFRIVHIVEVAGDPKLSPELVHTATEKLLTETHTKISDYDAIEWNEPFAAIDALF
NHYYPEEREKFNIFGGTLAYGHPYACSGIINILHLMQALKYKNKPMGLTAIAGAGGVGMA
ISIEYLGVKNA
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatagagatgtttatattggttttgggctacgaacacctatcggtataaaaggg
aagcaatttaaacattaccgtccagaacttttaggagcacaccttttaaatcaaataaaa
aaaatagaatcagaatctaacattgatagtattatttgtgggaacacagttggtactggg
ggcaatattggtcgtttgatgactcttttttctgattatgaatcctatattccagtacaa
acgattgatatgcagtgtgcttcatcaagttctgccttgttttttggttatctaaaaatc
agtaccggtattaatgaaaaagttcttgttggggggattgaaagtagttctcttcaacct
atgagacgttatgctaaagaagataatcgtaacggagaatatacagttgctcagttttct
cctgactcttatgctgaaactgtaatgttagaaggggcccagagagtctgtcaaaaatat
ggttttagaagagaaatgttagataaattggcattcttgagccataaacgcgccttaaca
gctaaacaaggtggctatttagaagaggtaatcttaccaatggaagggatgcgagatcaa
ggcgttagaaaactaaaagaaacattttttcaaaaattaccaagattgatggaaaattca
cctttgctcactattggaaatgtttgtttaatgcacgatgctgctgcatttctaacgctt
cagagtcagaaaacagaattccggattgttcacattgtagaagtagcaggagatcccaag
cttagtccagaattggttcacacggctacggaaaaactattaacagaaactcatactaaa
atatcggattatgatgcaattgaatggaatgaaccatttgcagcgattgatgctctattt
aatcattattatcctgaagagagagaaaaattcaatatttttggagggacattagcttac
ggacacccttatgcctgctcaggaattattaatatccttcatcttatgcaggcattaaaa
tataaaaataaacctatgggtctaactgccattgcaggggcaggaggagtcggaatggcc
atatcaatagagtacttaggagttaagaatgcttga

DBGET integrated database retrieval system