KEGG   Streptococcus agalactiae GD201008-001 (serotype Ia): A964_0501Help
Entry
A964_0501         CDS       T02248                                 

Gene name
glk
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
sgc  Streptococcus agalactiae GD201008-001 (serotype Ia)
Pathway
sgc00010  Glycolysis / Gluconeogenesis
sgc00052  Galactose metabolism
sgc00500  Starch and sucrose metabolism
sgc00520  Amino sugar and nucleotide sugar metabolism
sgc00521  Streptomycin biosynthesis
sgc01100  Metabolic pathways
sgc01110  Biosynthesis of secondary metabolites
sgc01120  Microbial metabolism in diverse environments
sgc01130  Biosynthesis of antibiotics
sgc01200  Carbon metabolism
Module
sgc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sgc_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sgc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A964_0501 (glk)
   00052 Galactose metabolism
    A964_0501 (glk)
   00500 Starch and sucrose metabolism
    A964_0501 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    A964_0501 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    A964_0501 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    A964_0501 (glk)
Enzymes [BR:sgc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     A964_0501 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG Hexokinase_2
Motif
Other DBs
NCBI-ProteinID: AFS45290
Position
514479..515447
Genome map
AA seq 322 aa AA seqDB search
MSKKLLGIDLGGTTIKFGILTLEGEVQEKWAIETNTLENGRHIVSDIVESLKHRLSLYGL
TKDDFLGIGMGSPGAVDRTSKTVTGAFNLNWADTQEVGSVIEKEVGIPFFIDNDANVAAL
GERWVGAGANNPDVVFVTLGTGVGGGVIADGNLIHGVAGAGGEIGHMIVDPENGFTCTCG
NKGCLETVASATGVVRVARQLAEQYEGSSAIKAAIDNGDTVTSKDIFIAAEDGDKFANSV
VERVSRYLGLAAANISNILNPDSVVIGGGVSAAGEFLRSRVEKYFVTFAFPQVKKSTKIK
IAELGNDAGIIGAASLANQQAS
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagaaattattgggaattgacctcggaggaacgaccattaaatttggtatcttg
acgcttgagggagaagtacaagaaaaatgggcaattgagaccaatactttagaaaacgga
agacatatcgtttctgatatcgttgaatctctcaaacatcgtttgagcctctatggatta
acaaaagatgactttctcggtatcggtatgggttctccaggagctgttgatagaactagt
aaaacagtaacaggtgcttttaatctaaattgggctgatactcaagaagtaggttcagtt
attgaaaaagaagttggaattccattttttattgataacgatgctaatgttgcagcactt
ggtgaacgctgggtaggtgctggtgccaataatcccgacgttgttttcgtaaccctcgga
acaggagtaggtggaggtgttatcgcagatggtaacctcatccatggtgttgcaggagca
ggtggagaaattgggcatatgattgttgatccagaaaatggatttacgtgcacatgtggt
aacaaaggctgccttgagacagttgcatcagcgacaggtgttgttagagtagcacgtcaa
ctcgcagaacaatatgagggttcgtctgccattaaagcagcgattgacaacggtgatact
gttacaagtaaagatatttttatagcagcagaagatggggataaatttgctaattctgtt
gttgaacgtgtatcacgttaccttggactggcagcagctaatatttcaaatattttaaac
cctgattctgtggttattggtggcggtgtctcagcagcaggtgaatttttacgtagtcgc
gttgagaaatactttgtcacatttgctttcccacaagttaaaaagtcaactaaaattaag
attgctgaactaggtaatgatgctggtattattggtgcagcaagcttagccaatcaacaa
gcaagttaa

DBGET integrated database retrieval system