KEGG   Streptococcus agalactiae GD201008-001 (serotype Ia): A964_0856Help
Entry
A964_0856         CDS       T02248                                 

Gene name
glgB
Definition
(GenBank) glycogen branching protein
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
sgc  Streptococcus agalactiae GD201008-001 (serotype Ia)
Pathway
sgc00500  Starch and sucrose metabolism
sgc01100  Metabolic pathways
sgc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sgc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    A964_0856 (glgB)
Enzymes [BR:sgc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     A964_0856 (glgB)
Exosome [BR:sgc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A964_0856 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBM_48 Alpha-amylase_C Alpha-amylase AMPK1_CBM Malt_amylase_C
Motif
Other DBs
NCBI-ProteinID: AFS45628
Position
884651..886519
Genome map
AA seq 622 aa AA seqDB search
MSNKDELYTFGIGENFHLQNYLGVHSENGSFCFRVWAPNAENVQVIGDFTDWRNRPLQMN
KNQAGVWEANSLDAREGDLYKYLVTRKGGQVVEKIDPMAVYMERRPGTASVIKVLRNKKW
EDGLWMGRRKRLGFQKRPINIYEVHAGSWKKDDFGHPMTFSQLKDYLIPYLVEMNYTHVE
FMPLMAHPLDMSWGYQLMGYFAFEHTYGTPEEFQDFVEACHKNNIGVLVDWVPGHFIQND
DALAYFDGTATYEYQNHDRAHNYRWGALNFDLGKNQVQSFLISSALFWIEHYHIDGIRVD
AVSNMLYLDYDEGPWEANQFGDNRNLEGYHFLRKLNKVIKERHPNVMMIAEESTASTPIT
KDLESGGLGFDFKWNMGWMNDILRFYEEDPLYRQYDFNLVTFSFMYIFNENFVLAFSHDE
VVHGKKSMMHKMWGDRYNQFAGLRNLYAYQMCHPGKKLLFMGSEFGQFLEWKYNDQLEWE
NLNDDMNQKMQRYTKQLNQFYKDHKCLWRIDDSFDGLEIIDADNKSETVLSFIRKDDKGD
LLLCVFNMTPVERPNFTIGVPQAGIYEEVLNTEMEEFGGVWKNHNPVTKTQVATWKDYDH
TLSFTLPALGASVWRIKRRLRK
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgtccaataaagatgagttatatacttttggaataggtgaaaattttcatctccagaat
tatttaggcgtacatagcgaaaatggaagcttttgtttcagagtttgggctcctaatgct
gaaaatgttcaagttattggagattttacagattggcgaaatcgacctctccaaatgaac
aaaaatcaagcaggagtttgggaagctaacagtttggatgcgcgcgaaggtgatttatat
aaatatttggttactcgtaaaggtggtcaagtagttgagaaaatcgatcctatggcagtt
tatatggaaagacgtcctggaactgcaagtgttattaaagttcttagaaataaaaagtgg
gaagatggtctttggatgggaaggcgcaaacgtctgggttttcagaagcgtccaattaat
atttacgaagttcatgctggttcatggaaaaaagatgattttggacatcctatgactttt
tctcagttaaaagattacttaatcccctaccttgttgagatgaattatactcatgttgaa
tttatgcccttaatggcacatccgcttgatatgagttggggatatcaattaatggggtat
tttgcttttgaacatacctatggtactccagaagaatttcaagactttgtagaagcatgt
cataaaaataatataggagttcttgtagattgggttccaggacactttattcagaatgac
gatgctttagcctatttcgatggaactgctacttatgagtatcaaaatcatgatcgtgcg
cataactatcgatggggagctctgaactttgatttaggaaaaaatcaagtacaatccttt
ttgatttcgagtgccttgttctggattgaacattatcatattgatggtattcgtgttgat
gcggttagtaatatgttatatctcgattatgatgaaggaccatgggaagctaaccaattt
ggggataatcgtaatttggaaggatatcactttttaaggaaacttaacaaagtaattaaa
gagcgtcatcctaatgttatgatgattgctgaagagtcaacagcttctaccccaataact
aaagacttagagtctggaggattgggttttgactttaaatggaatatgggctggatgaat
gatatcctgcgtttttatgaagaagatcctctctataggcaatatgattttaatttagtg
acttttagttttatgtatatattcaatgagaactttgtactagctttttcacatgatgaa
gtagtacatggtaaaaagagtatgatgcataaaatgtggggtgaccgttataatcaattt
gctggtttacgtaatttatatgcatatcaaatgtgtcatcctgggaaaaaacttctcttt
atgggaagtgagtttggtcaatttttagaatggaaatataatgatcaactagaatgggaa
aacttaaatgatgatatgaaccaaaagatgcaacgctatactaaacaattgaatcaattt
tataaagatcataagtgcctatggcgtattgatgattcctttgacgggctagaaattatt
gatgcggataataaatctgaaactgttttatcttttatacgaaaagatgataaaggcgat
ttgttactttgtgtctttaatatgactcctgtagaacgccctaactttactattggtgtt
ccgcaagcgggtatttatgaagaagttttaaatactgaaatggaagagtttggaggtgtt
tggaaaaaccacaatcctgtaacgaaaacacaagtggctacatggaaagattatgatcat
actttaagttttacattaccagcccttggggcaagtgtttggagaataaaacgtcggctt
cgtaaataa

DBGET integrated database retrieval system