KEGG   Streptococcus agalactiae GD201008-001 (serotype Ia): A964_1279Help
Entry
A964_1279         CDS       T02248                                 

Gene name
rluD
Definition
(GenBank) ribosomal large subunit pseudouridine synthase A
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
sgc  Streptococcus agalactiae GD201008-001 (serotype Ia)
Brite
KEGG Orthology (KO) [BR:sgc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:sgc03009]
    A964_1279 (rluD)
Enzymes [BR:sgc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     A964_1279 (rluD)
Ribosome biogenesis [BR:sgc03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    A964_1279 (rluD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4
Motif
Other DBs
NCBI-ProteinID: AFS46044
Position
complement(1325391..1326281)
Genome map
AA seq 296 aa AA seqDB search
MEITIKIAGVRLDKALADNSELSRSQANEEIKKGIVLVNGQVKKAKYTVQEGDRITFDIP
KEEVLDYQAENIPLDIIYQDDDVAVVNKPQGMVVHPSAGHSSGTLVNALMYHIKDLSSIN
GVVRPGIVHRIDKDTSGLLMVAKNDRAHQVLAEELKDKKSLRKYLAIVHGNLPNDRGVIE
APIGRSDKDRKKQAVTAKGKPAITRFHVLERFGDYTLVELSLETGRTHQIRVHMAYIGHP
LAGDPVYGPRKTLGGKGQFLHAQTLGFTHPSNGENLIFSVEVPEIFQTTLDKLRKN
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atggaaatcacaattaaaatagcaggagttaggctagataaagctttagctgataattct
gaactgtcgcgtagtcaagctaatgaagaaattaaaaaagggattgtgttagtaaatgga
caagtaaaaaaagcgaaatatactgttcaagaaggagatcggattacttttgatattcct
aaagaggaagtactagattatcaagctgagaatatccctttagatattatctatcaagat
gatgacgttgctgtggttaataagccgcaaggaatggttgttcacccttctgcaggccac
agttcgggcaccttagttaacgccttgatgtatcatattaaggatttatcatcaattaat
ggcgttgttcgcccagggatcgttcatcgtattgataaagatacttctggtttattgatg
gttgcaaaaaatgatagagctcaccaagtgttggctgaagagttaaaagataaaaaatcg
cttcgtaaatatttagcaattgtgcatggtaatttaccaaatgatcgaggtgtgattgag
gctccgattggtagaagcgataaagatcgtaagaagcaagccgtgactgctaaaggtaag
ccagcaataactcgttttcatgttttagaacgttttggtgattataccttagttgaattg
tcattggagacaggtcgaacacaccaaattcgggttcatatggcttatattggccatcct
ctagccggtgatcctgtctacggtccccgtaagactttagggggtaaaggacagtttttg
catgcacaaacactaggttttacgcacccaagtaacggagagaatttgattttttcagta
gaggttccggaaatttttcagacaaccttagacaagttgagaaaaaattaa

DBGET integrated database retrieval system