KEGG   Streptomyces griseoviridis: ELQ87_08030
Entry
ELQ87_08030       CDS       T06660                                 

Definition
(GenBank) hydrolase
  KO
K14630  two-component flavin-dependent monooxygenase [EC:1.14.14.-]
Organism
sgd  Streptomyces griseoviridis
Pathway
sgd01057  Biosynthesis of type II polyketide products
sgd01100  Metabolic pathways
sgd01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sgd00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01057 Biosynthesis of type II polyketide products
    ELQ87_08030
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:sgd01008]
    ELQ87_08030
Enzymes [BR:sgd01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.-  
     ELQ87_08030
Polyketide biosynthesis proteins [BR:sgd01008]
 Polyketide tailoring proteins
  Oxygenase
   ELQ87_08030
SSDB
Motif
Pfam: Acyl-CoA_dh_2 Acyl-CoA_dh_N Acyl-CoA_dh_M TPP_enzyme_N
Other DBs
NCBI-ProteinID: AZS84234
UniProt: A0A3S9Z8T7
Position
1868546..1869661
AA seq 371 aa
MHEETPGTAGPALPVEKLCALAAQQAQAADRAGALAPEVVEGLREAGFARHFVAARWGGA
EGSFAELTRAVVALGQACPATAWCASLSAYSARFACHLPQEGQRALWEGGQDVVIATGLM
PGGRAEPAGDGWRLRGRWSYVSGIDFADWVLLCAAVESGDGPPALRFFALPRGACQVRAD
WDSVGMRATASHTVVVESATVPGHLSFGRGDMMTGRNPHSTVPSHNVPFQAVGGLTFIAP
VLGAGTGALAAFAALLTGRRRTTANESALVRASGRVDAALRLVEENTRVLDGRLFTPAPM
ARNERNATFAAESVREAAGLLVAAAGTAGLGARHPLQRLWRDITAATSHVALQYDTAARK
NYAAVLAGPAE
NT seq 1116 nt   +upstreamnt  +downstreamnt
atgcacgaggagactccagggacggccggaccggcccttcccgtcgagaagttgtgcgca
ctcgccgcccagcaggcgcaggccgcggaccgggcgggcgcgctcgcgcccgaggtcgtc
gaggggctgcgcgaggcggggttcgcccggcatttcgtggccgccaggtggggtggcgcg
gagggctcgttcgccgaactcacccgcgcggtggtcgcgttgggccaggcgtgtccggcg
accgcgtggtgcgcctcgctcagcgcctactcggcgcggttcgcctgccaccttccgcag
gaggggcagcgggcgctgtgggagggcgggcaggacgtcgtgatcgccaccggtctgatg
cccggcggccgtgccgagccggccggggacggctggcggctgcgggggcggtggagttac
gtcagcgggatcgacttcgcggactgggtgctgctgtgcgcggccgtcgagtcgggggac
gggccgcccgcgctgcggttcttcgcgctgccccggggcgcctgccaggtgcgggccgac
tgggacagcgtcgggatgcgggccaccgcgagccacaccgtggtggtggagtccgccacc
gtccccggccatctgtcgttcgggcggggcgacatgatgaccggccgcaacccgcactcg
acggtcccctcccacaacgtgccgttccaggcggtcggcgggctcaccttcatcgcgccc
gtgctcggcgcgggcaccggcgcgctggccgcgttcgccgcgctgctcaccggcaggcgg
cgcaccacggccaacgagtcggccctggtgcgcgcctcgggccgggtcgacgccgcgctg
cgcctcgtcgaggagaacacccgggtcctggacggacggctgttcacccccgcccccatg
gcgcgcaacgagcgcaacgcgaccttcgccgcggagtcggtcagggaggccgcgggactg
ctggtcgccgcggcgggcaccgcggggctcggcgcccggcatccgctgcaacggctgtgg
cgggacatcacggcggcgacgagccatgtggcgctccagtacgacacggcggccaggaag
aactacgcggcggtcctggcgggccccgcggagtga

DBGET integrated database retrieval system