KEGG   Streptomyces griseorubiginosus: DWG14_00512Help
Entry
DWG14_00512       CDS       T06099                                 

Definition
(GenBank) hypothetical protein
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
sge  Streptomyces griseorubiginosus
Pathway
sge00361  Chlorocyclohexane and chlorobenzene degradation
sge00625  Chloroalkane and chloroalkene degradation
sge01100  Metabolic pathways
sge01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sge00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    DWG14_00512
   00361 Chlorocyclohexane and chlorobenzene degradation
    DWG14_00512
Enzymes [BR:sge01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     DWG14_00512
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase
Motif
Other DBs
NCBI-ProteinID: AYC36303
UniProt: A0A385ZBY4
Position
complement(587669..588349)
Genome map
AA seq 226 aa AA seqDB search
MPIPSFQFRPKYVSFDCYGTLIEWPMTPVTRELVGDQIPAEHWDQFVKEFRGYRYDSILD
AFRPYEQTLQDAFEGVCRKWGVKAAPDAGKRLADGVRSFGPHADVPEPLKKMGEHYKLVI
LSNAEDSFLAESVPRLGADFHAVFTAEQAGYYKPRYAAFEYMLDQLDASPEDFVHVSSHT
RYDLMPMHDMGFRNLVLLDRGYDPVTHGYDYVTVKSLDELNQMLGI
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgcccatcccctcgttccagttccgcccgaagtacgtctcgttcgactgctacggcacg
ttgatcgagtggccgatgacccccgtcacccgcgaactcgtcggtgaccagatcccggcc
gagcactgggaccagttcgtcaaggagttccgcggctaccgctacgactcgatcctcgac
gcgttccgtccctacgagcagacgctccaggacgccttcgagggggtctgccggaagtgg
ggcgtcaaggccgccccggacgccggcaagcggctggccgacggtgtgcgcagcttcggc
ccgcacgcggatgtgccggagccgctgaagaagatgggcgagcactacaagctcgtgatc
ctctccaacgccgaggactccttcctcgcggagagcgtgccccgcctcggcgcggacttc
cacgcggtcttcaccgcggagcaggccggctactacaagccccgctacgcggcgttcgag
tacatgctcgaccaactcgacgcgtcccccgaggacttcgtgcacgtctcctcgcacacc
cgctacgacctgatgccgatgcacgacatgggtttccgcaacctggtcctcctggaccgc
ggctacgacccggtcacccacggctacgactacgtgaccgtcaagtccctcgacgagctc
aaccagatgctcggcatctga

DBGET integrated database retrieval system