KEGG   Streptomyces griseorubiginosus: DWG14_01190Help
Entry
DWG14_01190       CDS       T06099                                 

Definition
(GenBank) L-fuconate dehydratase
  KO
K18334  L-fuconate dehydratase [EC:4.2.1.68]
Organism
sge  Streptomyces griseorubiginosus
Pathway
sge00051  Fructose and mannose metabolism
sge01100  Metabolic pathways
sge01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sge00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    DWG14_01190
Enzymes [BR:sge01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.68  L-fuconate dehydratase
     DWG14_01190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MR_MLE_C MR_MLE_N MAAL_C DUF3025
Motif
Other DBs
NCBI-ProteinID: AYC36980
UniProt: A0A385ZFT9
Position
complement(1352946..1354295)
Genome map
AA seq 449 aa AA seqDB search
MSPTTARITAVDTYDIRFPTSRELDGSDAMNPDPDYSAAYVVLRTDAPDRHEGHGFTFTI
GRGNDVQVAAIQALRGHVVGRSVDELSADPGTLYRDLVGDSQLRWLGPEKGVMHMAIGAV
VNAVWDLAAKRAEKPLWRLLAESDPEWLVGQIDFRYLTDALTPEEALDILRRGREGAPER
SAQLLAKGYPAYTTSAGWLGYDDDKLTRLAAQAVADGFRQIKLKVGADLDDDVRRCRVAR
RVVGPGIRMAIDANQRWDVDEAIRWTRALAEFDPYWIEEPTSPDDVLGHAAVRKAVAPVK
VATGEHVQNRIVFKQLLQAGAVDVVQIDAARVGGVNENLAVLLLAAKFGVPVCPHAGGVG
LCELVQHLSMFDYVAVTGTTEDRVIEYVDHLHDHFRDPVVIRDGHYTAPTAPGLSAEMYP
ESIARYTFPDGAFWAEDLADDTPKKGQAA
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
gtgtccccgaccaccgcccgcatcaccgcggtagacacctacgacatccgcttccccacc
tcgcgggagctcgacggctccgacgcgatgaacccggaccccgactactcggcggcctat
gtggtgctgcgcaccgacgcgcccgaccggcacgaggggcacggcttcaccttcaccatc
gggcgtggcaacgatgtccaggtcgccgcgatccaggcgctgcgcggccatgtggtcgga
cggtccgtcgacgaactgtccgcggaccccggcacgttgtaccgcgacctcgtcggcgac
agccaactgcgctggctcgggcccgagaagggcgtgatgcacatggcgatcggcgcggtc
gtcaacgccgtgtgggacctggcggccaagcgcgccgagaagcccctgtggcggctgctc
gccgagagcgaccccgaatggctggtcggccagatcgacttccggtacctcacggacgcg
ctcacccccgaggaggccctggacatcctgcgccggggccgggagggcgccccggaaaga
tccgcacagctcctggccaagggctaccccgcctacaccacctccgccggctggctcggc
tacgacgacgacaagctcacccggctcgccgcccaggccgtcgccgacggcttccggcag
atcaagctgaaggtcggcgcggacctggacgacgacgtacggcgctgccgggtcgcccgc
cgggtcgtcggccccggcatccgcatggcgatcgacgccaaccagcgctgggacgtcgac
gaggcgatccgctggacccgggccctcgccgagttcgacccgtactggatcgaggagccc
accagccccgacgacgtcctcggccacgcggccgtccgcaaggccgtcgccccggtcaag
gtcgccaccggcgagcacgtccagaaccggatcgtcttcaagcagctcctccaggccggg
gccgtcgacgtcgtccagatcgacgcggcccgcgtcggcggcgtcaacgagaacctcgcc
gtcctgctgctcgccgccaagttcggcgtcccggtctgcccgcacgcgggcggcgtcggc
ctgtgcgaactcgtccagcacctctcgatgttcgactacgtggccgtcaccggcaccacc
gaggaccgggtcatcgagtacgtcgaccatctccacgaccacttccgggaccccgtggtg
atcagggacggccactacacggcacccaccgctcccggtctctccgccgagatgtacccg
gagtccatcgcgcgctacacgttcccggacggcgccttctgggcagaagatctcgccgac
gacacaccgaagaaggggcaggcggcatga

DBGET integrated database retrieval system