KEGG   Streptomyces griseorubiginosus: DWG14_02009Help
Entry
DWG14_02009       CDS       T06099                                 

Gene name
cyc2
Definition
(GenBank) Germacradienol/geosmin synthase
  KO
K10187  germacradienol/geosmin synthase [EC:4.2.3.22 4.2.3.75 4.1.99.16]
Organism
sge  Streptomyces griseorubiginosus
Pathway
sge00909  Sesquiterpenoid and triterpenoid biosynthesis
sge01100  Metabolic pathways
sge01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sge00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    DWG14_02009 (cyc2)
Enzymes [BR:sge01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.16  geosmin synthase
     DWG14_02009 (cyc2)
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.22  germacradienol synthase
     DWG14_02009 (cyc2)
    4.2.3.75  (-)-germacrene D synthase
     DWG14_02009 (cyc2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Terpene_synth_C
Motif
Other DBs
NCBI-ProteinID: AYC37791
UniProt: A0A385ZFS8
Position
complement(2309880..2312042)
Genome map
AA seq 720 aa AA seqDB search
MTQQPFELPHFYMPYPARLNPHVDEARAHSTAWAREMGMLEGSGIWEQSDLDAHDYGLLC
AYTHPDCDGPALSLITDWYVWVFFFDDHFLEIFKRTQDRAGGKAYLDRLPLFMPMDLTTP
MPEPENPVEAGLADLWTRTVPSMSADWRRRFAVATEHLLNESLWELSNINEGRIANPVEY
IEMRRKVGGAPWSAGLVEYATAEVPAAVAGSRPLRVLMETFSDAVHLRNDLFSYQREVED
EGELSNGVLVLETFFGCTTQEAADTVNDVLTSRLHQFEHTALTEVPAVALEKGLSPAEVA
AVAQYTQGLQDWQSGGHEWHMRSSRYMNARAETTSPWQSLTGPGTSAADVGALLAAAGAE
RLRAHTHVPFQKVGPSLLPDFHMPFQVEHSPHLLGARPRLTAWMHRMGMLQEGVWDEDRL
AAADLPLCAAGIDPDASAEALDLSSHWLAWGTYGDDYYPLVYGARRDLAAARLTTHRLSQ
CMPLDGQQTLVPVNGMERGLTDLWARTTAEMTPDQRRTLKDAVNAMTESWVWELANQIHH
RVPDPVDYLEMRRATFGSDLTMSMCRMGHGPAVPPEVYRSGPVRSLENAAVDYACLLNDV
FSYQKEIEYEGEIHNAILVVQNFFGIDYPTALRVVHDLMTQRMQQFEHVAANELPVVYDD
FGLSAEAREVMRGYVTDLQHWMAGILHWHRTVDRYKSDYLAGRTHGFLPDRAPTTLSVAG
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atgacgcagcagcccttcgaactcccgcacttctacatgccgtaccccgcgcggctgaac
ccgcacgtcgacgaggcgcgcgcccactcgaccgcgtgggcgcgcgagatgggcatgctg
gaggggtccgggatctgggagcagtccgacctcgacgcgcacgactacggcctgctctgc
gcctacacacacccggactgcgacggccccgcgctctcgctgatcaccgactggtacgtg
tgggtgttcttcttcgacgaccacttcctggagatcttcaagcgcacccaggaccgcgcc
ggcggcaaggcctacctggaccggctgccgctgttcatgccgatggacctcaccaccccg
atgcccgagcccgagaacccggtcgaggcgggcctcgccgacctgtggacgcgcaccgtc
ccgtcgatgtccgccgactggcgccgacgtttcgccgtcgccaccgaacacctgctcaac
gagtccctgtgggagctctccaacatcaacgaggggcggatcgccaaccccgtcgagtac
atcgagatgcgccgcaaggtcggcggcgccccctggtcggccgggctcgtggagtacgcg
acggccgaggtcccggccgcggtcgccgggtccaggccgctgcgcgtcctgatggagacc
ttctccgacgccgtgcacctgcgcaacgacctcttctcctaccagcgcgaggtcgaggac
gagggcgagctcagcaacggcgtgctcgtcctggagaccttcttcggctgcaccacccag
gaggccgccgacaccgtcaacgacgtcctcacctcccgcctccaccagttcgagcacacc
gcgctgaccgaggtacccgccgtcgccctggagaaaggtctctccccggccgaggtcgcc
gccgtcgcccagtacacgcagggactccaggactggcagtccggcggccacgaatggcac
atgcgctccagtcgctacatgaacgcccgggccgagaccacctccccctggcagagcctg
accggccccggcacctcggccgccgacgtcggcgccctgctcgccgcggccggcgcggag
cggctgcgcgcccacacgcatgtgccgttccagaaggtcgggccgtcgctgctgcccgac
ttccacatgccgttccaggtcgagcacagcccccacctgctcggcgcccgcccccgcctc
accgcgtggatgcaccgcatgggcatgctccaggagggcgtctgggacgaggaccggctc
gccgcggccgacctcccgctgtgcgccgcgggcatcgacccggacgcgagcgccgaggcc
ctcgacctcagctcgcactggctggcctggggcacctacggcgacgactactaccccctc
gtctacggagcccgccgcgacctcgccgccgcccgcctcaccacccaccgtctctcgcag
tgcatgcccctcgacggccagcagaccctcgtacccgtcaacggcatggaacgcggcctg
accgacctgtgggcccgcaccacggccgagatgacccccgaccagcggcgcaccctcaag
gacgccgtgaacgcgatgaccgagagctgggtgtgggagctggccaaccagatccaccac
cgggtccccgatcccgtcgactacctggagatgcggcgcgccaccttcggctccgacctc
accatgagcatgtgccggatgggccacggccccgccgtcccgcccgaggtctaccgcagc
ggacccgtccgctccctggagaacgccgccgtcgactacgcctgtctgctcaacgacgtc
ttctcgtaccagaaggagatcgagtacgaaggcgagatccacaacgcgatcctcgtcgtg
cagaacttcttcggcatcgactacccgaccgcgctgcgggtcgtccatgacctgatgacc
cagcgcatgcagcagttcgagcacgtcgccgcgaacgaactgcccgtcgtgtacgacgac
ttcgggctctctgcggaggcccgcgaggtgatgcgcggctatgtgaccgacctccagcac
tggatggcgggcatcctgcactggcaccgcacggtcgaccgctacaagtccgactacctg
gccggccgcacccacggcttcctcccggacagggccccgacgacgctgtcggtggcgggc
tga

DBGET integrated database retrieval system