KEGG   Streptomyces griseorubiginosus: DWG14_02535Help
Entry
DWG14_02535       CDS       T06099                                 

Definition
(GenBank) Beta-glucosidase BoGH3B
  KO
K05349  beta-glucosidase [EC:3.2.1.21]
Organism
sge  Streptomyces griseorubiginosus
Pathway
sge00460  Cyanoamino acid metabolism
sge00500  Starch and sucrose metabolism
sge01100  Metabolic pathways
sge01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sge00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    DWG14_02535
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    DWG14_02535
Enzymes [BR:sge01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     DWG14_02535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3 CBM_11 Glyco_hydro_3_C Calx-beta CIA30
Motif
Other DBs
NCBI-ProteinID: AYC38306
UniProt: A0A385ZGV5
Position
complement(2930450..2933464)
Genome map
AA seq 1004 aa AA seqDB search
MRRTALLVSAALLTSLLPVAVARAAADDPPPIPVDRFEGEVPFASPPAGGIFTWGGDSDD
PPALQLSTRGDAPEGDKVLAGTYDISGYGGFTHDFAFAEPAHDWSARKGVRFWWEGQNNG
KKVAFELKDGGANGEASELWTTSFTDDFTGWKQIELPFTDFAYRTDYQPVGGIDHVLGLT
ETWGYAVTLPVGAPGRFALDGVELYGRADQSLRASVSTDSAVHPVREGGTAKIKVTVATT
GSVPLGDPVTVAYETAGGTATPGKDYTPVSGTLTFPAGTASGATRTVQVPTLKDKGAESA
ETIPVKLTVTGAKPPAETPQVVIDAHGLPYLNSKLPVQRRVADLLSRMSLAEKAGQMTQA
ERGAVGAGADVTAYDLGSLLSGGGSTPTPNTPEAWAKMIDSFQLRSRATRFQIPLIYGVD
AVHGHNNLVGATVMPHNIGLGATRNPQLVQRTGSVTAAEVRATGVPWDFAPCLCVTRDER
WGRSYESFGEDPALVESMETIIQGLQGARNGNDLDRDDKVLATAKHFVGDGGTAYGSSTT
GTYTIDQGVTTVTRQQLEAVHLAPFKEAVQRGIGTVMPSYSSLDVVGDGLGPVKMHARAD
MIDGVLKQKLGFDGFVISDWNGIDQIPGDYASDVRTSVNAGVDMIMAPYAYKDFHSALMA
EVRAGRVSEQRIDDAVSRILTQKFRLGLFEKPYADTSGASKIGSAGHRAVAREAAAASQV
LLKNAGDVLPLRKSQKVYVAGSNADDIGNQSGGWTVTWQGSSGAITPGTTILEAMRKNSA
ALTYSKDASAPLSGYDVGVVVVGETPYAEGVGDVGNGHDLALSAADQAAVDKVCAAMKCA
VLIVSGRPQIVGDRLGDIDALVASWLPGTEGDGVADVLYGKRPFTGRLPVTWPRSQAQLP
INVGDPAYDPQFPYGWGLTTLTKVPKGGQSTLKALGAAASRAERAGADGTGRALVAEARL
IVQQRAAGRMTAAVAAPFADADHLLLTGRYGEAVAKLTQAYRAA
NT seq 3015 nt NT seq  +upstreamnt  +downstreamnt
atgcgaagaaccgccctgctcgtctccgccgccctgctcacctccctgctgcccgtggcg
gtcgcccgcgcggcggccgacgatccgcccccgatccccgtcgaccgcttcgagggcgag
gtccccttcgcgagcccgcccgcgggcggcatcttcacctggggcggcgacagcgacgac
ccgccggccctccagctgagcacacgcggcgacgcccccgagggcgacaaggtgctcgcc
ggcacctacgacatcagcggctacggcggcttcacccacgacttcgccttcgccgagccc
gcccacgactggtccgcccgcaagggcgtccgcttctggtgggagggacagaacaacggc
aagaaggtcgccttcgagctcaaggacggcggcgccaacggcgaggcctccgagctgtgg
accacctccttcaccgacgacttcaccggctggaagcagatcgagctccccttcaccgac
ttcgcctaccgcaccgactaccagcccgtcggcggcatcgaccacgtcctcggactcacc
gagacctggggctacgccgtcaccctcccggtcggagcgcccggccgattcgccctggac
ggcgtcgagttgtacggccgggccgaccagtcgctgcgcgcgagcgtcagcaccgactcc
gccgtccacccggtccgggagggcgggaccgcgaagatcaaggtcaccgtcgccaccacc
ggctccgtcccgctcggcgaccccgtgacggtcgcctacgagacggccggcggcaccgcc
acccccggcaaggactacacccccgtctccggcacgctcaccttcccggcgggtacggcc
tccggcgcgaccaggaccgtccaggtcccgaccctcaaggacaagggcgccgagtccgcc
gagaccatccccgtcaagctcaccgtcaccggcgccaagccgcccgccgagaccccgcag
gtcgtcatcgacgcgcacgggctgccgtatctgaacagcaagctccccgtgcagagacgg
gtcgccgacctgctctcccggatgagcctcgcggagaaggccgggcagatgacccaggcc
gagcgcggagccgtcggcgccggagccgacgtcaccgcctacgacctcggttcgctgctg
tccggcggcggttcgacccccacgcccaacacccccgaggcctgggcgaagatgatcgac
tccttccaactccggtcgcgggccacgcggttccagatcccgctgatctacggcgtcgac
gccgtccacggtcacaacaacctggtcggcgccaccgtgatgccccacaacatcggactc
ggcgcgacccggaatccccaactcgtccagcgcacagggtccgtgaccgcagccgaggtc
cgcgccaccggcgtcccgtgggacttcgcaccctgcctctgcgtcacccgcgacgaacgg
tggggccgctcctacgagtccttcggcgaggacccggccctcgtcgagtccatggagacg
atcatccagggcctccaaggagcgaggaacggcaacgacctcgaccgcgacgacaaggtc
ctcgccaccgccaagcacttcgtcggcgacggcggcaccgcctacggctcgtccacgacg
gggacgtacaccatcgaccagggcgtcaccacggtcacccggcagcagctcgaagccgtc
catctcgcacccttcaaggaggccgtgcagcggggcatcggcacggtcatgccgtcctac
tcctccctcgacgtcgtcggcgacggcctcggcccggtcaagatgcacgcccgcgccgac
atgatcgacggagtgctgaagcagaagctgggcttcgacggcttcgtcatcagcgactgg
aacggcatcgaccagatccccggcgactacgcctccgacgtccggacctccgtcaacgcc
ggcgtcgacatgatcatggcgccctacgcgtacaaggacttccactccgcgctcatggcg
gaggttcgggccgggcgcgtcagcgagcagcggatcgacgacgccgtctcccgcatcctc
acccagaagttcaggctgggcctcttcgagaagccgtacgccgacaccagcggcgcctcg
aagatcggttccgccggtcaccgcgccgtggcacgcgaggcggccgccgcgtcgcaggtg
ctgctcaagaacgcgggcgacgtgctgccgctgcggaaatcccagaaggtgtacgtcgcc
gggtccaacgccgacgacatcggcaaccagtccggcggctggaccgtcacctggcagggc
tcgtccggcgccatcacccccgggacgacgatcctggaggccatgcggaagaactccgcc
gcgctgacgtactcgaaggacgcctccgcaccgctgagcggctacgacgtcggtgtggtc
gtcgtcggcgagaccccgtacgccgagggcgtcggggacgtgggcaacggccacgacctg
gcgctgtccgccgccgaccaggcagccgtcgacaaggtgtgcgcggcgatgaagtgcgcg
gtgctgatcgtctccgggcggccgcagatcgtcggcgaccggctcggcgacatcgacgcc
ctggtcgcctcctggctgccgggcaccgagggcgacggcgtcgcggacgtcctgtacggc
aagcggcccttcaccggccggctgcccgtcacctggccccggtcacaggcccagctgccg
atcaacgtcggcgacccggcgtacgacccgcagttcccgtacggctggggcctgaccacc
ctcaccaaggtccccaagggcgggcagagcaccctgaaggcgctcggggccgcggcgagc
agggccgagcgggcgggggccgacgggacgggccgcgcgctcgtcgccgaggcccggctg
atcgtccagcagcgggcggccgggcggatgacggccgccgtggccgctcccttcgcggac
gccgaccacctgctgctgaccggacgctacggggaggcggtggcgaagctgacccaggcg
taccgggcggcctga

DBGET integrated database retrieval system