KEGG   Streptomyces griseorubiginosus: DWG14_03620Help
Entry
DWG14_03620       CDS       T06099                                 

Gene name
hemL
Definition
(GenBank) Glutamate-1-semialdehyde 2,1-aminomutase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
sge  Streptomyces griseorubiginosus
Pathway
sge00860  Porphyrin and chlorophyll metabolism
sge01100  Metabolic pathways
sge01110  Biosynthesis of secondary metabolites
sge01120  Microbial metabolism in diverse environments
Module
sge_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:sge00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    DWG14_03620 (hemL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sge01007]
    DWG14_03620 (hemL)
Enzymes [BR:sge01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     DWG14_03620 (hemL)
Amino acid related enzymes [BR:sge01007]
 Aminotransferase (transaminase)
  Class III
   DWG14_03620 (hemL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AYC39383
UniProt: A0A385ZKD4
Position
complement(4144336..4145655)
Genome map
AA seq 439 aa AA seqDB search
MSELPYSYDAPVSQALFDRASAVTPGGVNSPVRAFRAVGGTPRFMVSGTGPYLTDADGRE
YVDLVCSWGPMILGHAHPEVIAAVQEAVSRGTSFGTPGEGEVALAEEIVARVEPVDQVRL
VSSGTEATMSAIRLARGFTRRTKVIKFAGCYHGHVDSLLAAAGSGVATFALPDTPGVTGA
QAGDTIVLPYNDLEAVHEAFHRHPGEIACVITEASPGNMGVVPPLPGFNQGLKDACAQNG
ALYISDEVMTGFRTSRSGWYGIDGVRPDLMTFGKVMGGGFPAAAFGGRADVMAHLAPAGP
VYQAGTLSGNPVATAAGLAQLRLLDDAAYDKVDAVSRQIQSLVSEALGKEGVAHTVQNAS
NMFSVFFTDRAVRNYEDAKAQESFRFTAFFHSLLENGVYLPPSSFESWFVSTAHDEQAVQ
RIADALPAAARAAAEATAA
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaactgccctattcgtacgatgcgcctgtctcgcaggccctgttcgaccgcgcg
tcggccgtcacgcccggcggtgtgaactccccggtccgcgccttccgtgccgtgggcggc
accccccgcttcatggtgtccggcaccggcccgtacctgacggacgccgacgggcgcgag
tacgtcgacctcgtctgctcctgggggccgatgatcctcgggcacgcgcaccccgaggtg
atcgccgccgtccaggaggcggtgtccaggggcacctccttcggcacccccggtgagggc
gaggtcgcgctcgccgaggagatcgtggcccgggtcgagcccgtcgaccaggtgcggctg
gtctccagcgggaccgaggccaccatgtccgcgatccggctcgcccgcggcttcacccgg
cgcaccaaggtcatcaagttcgccggctgctaccacggtcacgtcgactcgctcctcgcc
gcggcgggcagcggggtcgccaccttcgcgctgcccgacacccccggcgtcaccggcgcc
caggccggcgacacgatcgtgctgccgtacaacgacctggaggccgtccacgaggccttc
caccggcaccccggcgagatcgcctgtgtgatcaccgaggcctcgcccggcaacatgggc
gtcgtgccgccgctgcccggcttcaaccaggggctcaaggacgcctgcgcgcagaacggc
gccctgtacatctccgacgaggtcatgaccgggttccggaccagccgcagcggctggtac
ggcatcgacggcgtccggcccgacctcatgaccttcgggaaggtcatgggcggtggcttc
cccgccgccgccttcggcggccgggccgacgtcatggcgcacctcgcgcccgccgggccc
gtctaccaggccggcaccctctccggtaaccccgtcgccaccgccgccggcctcgcccag
ctgcggctcctcgacgacgcggcctacgacaaggtcgacgccgtgtcccggcagatccag
tccctggtctccgaggcgctcggcaaggagggcgtcgcgcacaccgtgcagaacgcctcc
aacatgttctccgtgttcttcacggaccgcgcggtgcggaactacgaggacgccaaggcg
caggagtccttccggttcaccgcgttcttccactcccttctggagaacggcgtctacctg
ccgccgtcctccttcgagtcgtggttcgtgtccacggcccacgacgagcaggcggttcag
cggatcgccgacgcccttccggcggcggcccgagcggcggcggaggccacggcggcatga

DBGET integrated database retrieval system