KEGG   Streptomyces griseofuscus: HEP81_07915
Entry
HEP81_07915       CDS       T07010                                 

Definition
(GenBank) DegT/DnrJ/EryC1/StrS family aminotransferase
  KO
K13308  dTDP-4-amino-4,6-dideoxy-D-glucose transaminase [EC:2.6.1.33]
Organism
sgf  Streptomyces griseofuscus
Pathway
sgf00523  Polyketide sugar unit biosynthesis
sgf01100  Metabolic pathways
sgf01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sgf00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    HEP81_07915
Enzymes [BR:sgf01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.33  dTDP-4-amino-4,6-dideoxy-D-glucose transaminase
     HEP81_07915
SSDB
Motif
Pfam: DegT_DnrJ_EryC1 Aminotran_1_2 Beta_elim_lyase Cys_Met_Meta_PP
Other DBs
NCBI-ProteinID: QNT98143
UniProt: A0A7H1QCW3
Position
pSGRIFU1:88018..89217
AA seq 399 aa
MKRALTDLAVFGGPEAFLRPLLVGMPTVGDRARFLARLEWALDNEWLTNGGPLATELEGR
IADIAGVRYAVATCNATAALQLVLKASGITGQVIMPSLTFAATPHAASWVGLEPVFCDVD
PVTGCLDPGRVEKLITPETGAILGVHLWGRAAPVLELEKLAAEHGLRLFFDAAHAFGCTA
GGRPVGGFGDAEVFSFHATKTVMAFEGGAVTTDDGELAERLVALRNFGIDRDKSVTAVGM
NAKMSECSAAMGLTSLDAFPATRERNRENHALYQAELTGVPGTEVLSFHEHERNNHQYVI
LRTDRAVTGLHRDRLRALLQAEKVFPQLYFSPPCHLMPAYRTDPPLRLEHTERLSEQVLA
LPTGPSVSFEDIRRVCSIIRLAAERGAQIDAMWAQTALS
NT seq 1200 nt   +upstreamnt  +downstreamnt
atgaagcgcgcgctcaccgatctcgcggtcttcgggggtcccgaggcgttcctgcgcccg
ctcctggtgggcatgcccaccgtcggcgaccgggcgcggttcctcgcccggctcgaatgg
gccctggacaacgagtggctgaccaacggcggcccgctggccaccgaactggagggccgc
atcgccgacatcgccggggtgcggtacgccgtggcgacctgcaacgccaccgcggcgctg
caactggtcctgaaggcctcgggcatcaccggacaggtgatcatgccctcgctgaccttc
gcggcgactccgcacgcggcgagctgggtggggctcgaaccggtgttctgcgacgtcgac
ccggtcaccggctgcctcgaccccggccgggtcgagaagctgatcacccccgagaccggg
gccatcctcggcgtccacctgtggggccgggcggccccggtcctggagctggagaagctg
gccgccgagcacgggctgcgactgttcttcgacgcggcccacgccttcggctgcaccgcc
ggcggccggccggtcggcggcttcggggacgcggaggtgttcagcttccacgccaccaag
acggtcatggccttcgagggcggcgcggtgaccaccgacgacggcgaactggccgaacgg
ctcgtggccctgcgcaacttcggcatcgaccgggacaagtccgtgaccgcggtcggcatg
aacgccaagatgagcgagtgctcggccgccatgggtctgacctccctcgacgccttcccg
gcgacccgcgagcgcaatcgtgagaaccacgccctctaccaggcggaactgaccggcgtc
cccggcaccgaggtgctctccttccacgagcacgaacgcaacaaccaccagtacgtgatc
ctgcggacggaccgcgccgtcaccggtctgcaccgcgaccggctgcgggccctgctgcag
gccgaaaaggtcttcccccagctgtacttctcacccccctgccatctgatgcccgcctac
cggaccgaccccccgctgcggctggaacacaccgagcgcctgtccgagcaggtactcgcg
ctgcccaccgggccgtcggtgtccttcgaggacatccgccgggtgtgcagcatcatccgg
ctcgccgcggagcgcggcgcgcagatcgatgcgatgtgggcccaaacagcgctctcctga

DBGET integrated database retrieval system