KEGG   Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069: SGGBAA2069_c05210Help
Entry
SGGBAA2069_c05210 CDS       T01444                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
sgg  Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069
Pathway
sgg00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sgg01100  Metabolic pathways
sgg01110  Biosynthesis of secondary metabolites
sgg01130  Biosynthesis of antibiotics
sgg01230  Biosynthesis of amino acids
Module
sgg_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sgg00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SGGBAA2069_c05210 (trpC)
Enzymes [BR:sgg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     SGGBAA2069_c05210 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS
Motif
Other DBs
NCBI-ProteinID: CBZ47693
Position
554308..555075
Genome map
AA seq 255 aa AA seqDB search
MSKEFLPTILKQKAKEVEELETESLQPLRETYKLYDYLKNNAKKLQVIAEVKKASPSLGD
INLDVDIVKQAKTYQDSGAAMISVLTDPFFFKGDIDYLRQISSQVSIPTLAKDFIIDEKQ
IIRSRNAGATVILLIVAALPEARLKELYDFATGLGLEVLLETHNLPELEVAHRIGAKIIG
VNNRNLVTFETDINTSLELSAHFKEMPVYISESAIFTKDDATLVAPFFNGILVGTALMKA
DNVSEKVKELQIDEG
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaagaatttctcccaactatcttgaagcaaaaagcaaaagaagtggaagagtta
gaaacggaatccttacaaccacttcgtgagacttacaagctgtatgactatctcaaaaat
aatgccaagaaacttcaagtgattgctgaagtcaaaaaagctagtcctagccttggtgac
attaatcttgatgtcgacattgtcaaacaagctaaaacttaccaggatagcggtgcggca
atgatttcggtgctgacagaccctttcttctttaaaggtgacattgattacctccgtcag
atttctagtcaagtgagtattccaacgcttgccaaagatttcattattgatgaaaaacaa
atcattcgtagtcgtaatgcaggagcaacagtgattttgttgattgtggcagctttgcca
gaagctcgcttgaaagagctttatgattttgcgacagggttaggactagaagttttactc
gaaacgcataatttacctgaattggaagtcgcacatcgcattggtgctaaaattatcggc
gttaataaccgtaatttagtgacttttgaaacagatattaataccagcttagaattatca
gcgcattttaaagaaatgccagtttatatttcagaatcagctattttcaccaaagacgac
gctaccttggttgccccatttttcaatggcatcttagttggcacggcattgatgaaagca
gataatgtttctgaaaaagtgaaggagttgcaaattgacgaaggttaa

DBGET integrated database retrieval system