KEGG   Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069: SGGBAA2069_c18840Help
Entry
SGGBAA2069_c18840 CDS       T01444                                 

Gene name
adh1
Definition
(GenBank) Alcohol dehydrogenase superfamily,zinc-containing
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
sgg  Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069
Pathway
sgg00010  Glycolysis / Gluconeogenesis
sgg00350  Tyrosine metabolism
sgg00625  Chloroalkane and chloroalkene degradation
sgg00626  Naphthalene degradation
sgg01100  Metabolic pathways
sgg01110  Biosynthesis of secondary metabolites
sgg01120  Microbial metabolism in diverse environments
sgg01130  Biosynthesis of antibiotics
sgg01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sgg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SGGBAA2069_c18840 (adh1)
  Lipid metabolism
   00071 Fatty acid degradation
    SGGBAA2069_c18840 (adh1)
  Amino acid metabolism
   00350 Tyrosine metabolism
    SGGBAA2069_c18840 (adh1)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SGGBAA2069_c18840 (adh1)
   00626 Naphthalene degradation
    SGGBAA2069_c18840 (adh1)
Enzymes [BR:sgg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SGGBAA2069_c18840 (adh1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C FAD_binding_2 AlaDh_PNT_C Sacchrp_dh_NADP PK_C Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: CBZ49056
Position
complement(1940714..1941757)
Genome map
AA seq 347 aa AA seqDB search
MKSAIFEKAGLMTVEEVAKPTLQADDDVIIKVVRACVCGSDLWSYANGDEKAAHSENSGH
EALGIVEEVGSAITTVQPGDFVIVPFTHGCGECDACRAGFDGTCDNHPGYTNWSSGFQSE
YVRFHYANWALIKIPGQPSDYSEGMMKSLLTLADVMPTGYHAARVADVKRGDKVVVIGDG
AVGQCAVIAAKMRGASQIVLMSRHEDRQQMALASGATAVVAERGEEGIAKVRQILGGGAD
AALECVGTEAAIEQALGVIHNGGRVGFVGVPHYNNRPLGSTFAQNITVGGGSASVTTYDK
QLLLKAVLDGDINPGRVFTNTYRLDDINQAYKDMQDRKAIKSMIVMD
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaaatctgctatttttgaaaaagctggtctgatgactgttgaagaagtggctaagcca
actttgcaagctgacgatgatgttattatcaaggtcgttcgtgcatgcgtctgcggttct
gacctttggtcttatgctaatggtgatgaaaaagctgcacattctgaaaactcaggtcac
gaagctctcggtattgttgaagaagttggttctgccattacgaccgtacaacctggtgat
tttgtcatcgtgccatttactcacggttgtggggaatgtgatgcttgccgtgctggtttt
gacggaacgtgtgataaccaccctggctatacaaactggtcttctggtttccaatcagaa
tatgtccgtttccactatgctaactgggctttgattaaaatccctgggcaaccgtctgat
tattcagaaggtatgatgaaatcactccttactttggctgatgttatgccaacaggttac
catgctgcgcgtgttgccgacgtaaaacgtggcgataaagtcgttgttattggtgatgga
gcggttggacaatgtgccgttattgcggcgaaaatgcgcggagcttctcagattgtcttg
atgagccgacacgaagaccgtcaacaaatggcgcttgcttcaggagctaccgctgtcgtt
gctgaacgcggtgaagaaggcattgctaaggttcgtcaaattctcggcggaggagctgac
gctgctcttgaatgtgtcggtacagaagccgctatcgagcaagctctcggtgttatccac
aatggcggacgtgttggatttgttggtgtccctcattacaataatcgtccgctaggttca
acatttgcacaaaacattactgtcggaggcggttcagcttctgtcactacctacgacaaa
caactccttcttaaagcagtccttgacggtgacatcaacccaggtcgcgtctttacaaac
acttatcgcttggacgacatcaaccaagcctacaaagacatgcaagaccgcaaagcaatc
aaatcaatgattgtcatggactaa

DBGET integrated database retrieval system