KEGG   Sinocyclocheilus grahami: 107548275
Entry
107548275         CDS       T04918                                 

Definition
(RefSeq) A disintegrin and metalloproteinase with thrombospondin motifs 13-like
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
sgh  Sinocyclocheilus grahami
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sgh01002]
    107548275
Enzymes [BR:sgh01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     107548275
Peptidases and inhibitors [BR:sgh01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   107548275
SSDB
Motif
Pfam: TSP1_ADAMTS Reprolysin ADAM_CR_2 TSP_1 Reprolysin_4 Reprolysin_5 Reprolysin_3 TSP1_spondin TSP1_CCN Reprolysin_2 Peptidase_M10
Other DBs
NCBI-GeneID: 107548275
NCBI-ProteinID: XP_016084391
Position
Unknown
AA seq 1377 aa
MGTLIWFFLVPSLIKTTALLISQCTLQKDFLESLKPQDLFYYFDTISVKSVPHFELVWVN
CSGNESFRGLWRCSFQSDGESFELGQHRDEQPVSCPTSLETVINSTVSVMKKREDMCCEQ
LKLLRPAHTRTLLPICHGKLQGLIQSGKKRLNIRPVHQKHIDHLKELTMDLPSGVPHLLL
THTLPVRTRLKQPKSQFRLRRTPLGSEVTHLELAVVVGPDVYDAHRQDTERYILTNLNIA
SELLRDVTLGANIRVHLVRMVILTEPKPDIQISENITSSLKSVCEWGQKVNPDADTDPLH
ADLLLYITRFDLVLPKGNKLVRGVTQLGGVCSSQWNCVITEDTGFDLGITIAHEIGHSFG
INHDGIDNTCSSSGFMMASDGGYNSVDLTWSQCSRAQLHNFFSAGKAECVKDVPVLGASV
QDWRPGLFYGVDDQCRIAFGSSATACSFTNGDMATCRVLSCHINPRDRSSCTRLLVPLLD
GTECGPSQWCLKGRCVSPSTLGSSMMVHGSWSSWSELSVCSRTCGGGITYRRRQCNNPRP
AFSGTVCKGQDTEAELCNRQSCESTQLEFMSQQCSATDQQPLSVSPDSSSVYTWIPAVGY
SAGDAQCKLLCRSREQDFMVSRGSQFIDGTRCEAGHTVPRGSISACLGGKCQLFGCDGVM
HSGKMEDVCGVCGGNGSTCQFISNTYSGGEVGEYVTFLSLPLNASQVHVINTKPVFTHLA
VLSNDKYGVGERVRSVTCVQKQGMVKVELPDSDCMLDSKPQTTETCNPQICPARWQVSEP
GECSAVCGPGEAQRTVSCIRSHHESDSEVDQNLCPEPKPREHVPCVVDVCPVGWDSQREL
IRTDTHVMPRSSMVPVYVWSPVIGQCSKTCGNGSQQVWFSCVDHQSRLEVPEFLCDRTNK
PEMYTQPCSLSICPATWRYIQGPCSVXXXXLYCSQMVQGGDGNTDLVVGESACQSVARPS
EVVECNTEACPTRWQAGEQGDCSVSCGMGVAVRSVRCVQYEGGVERVVEEDRCDPGNKPP
VTAPCFTQVCSFHWDVHEWSECSVSCGDGIQSRTVSCMGPSSPLPVSPFLCLHLPKPITI
QACYSPDCSSAQTSTPEPNSTHMQSETRRGEGTWRTTPAPAVRMMKMRKSFSAIVPTADV
MRSTMSTTEPPQTSFCGQLLLQDSGTIDLRNVTQARCIFTIGRPLDEVIQIKIISSTLNC
RQKENIALYDRLILMRLCERMTSKTLKSRSNVLLVRQSRLTPGNGVLLFYQSIKNKKSHH
GECDVQLFSPSGLIENPIKSAATSNTQSCRVFIDAPPAFRIQIRALSVLNNTDTNSTYIL
IRDVDALKTTIFRGTRLFLWSSSGSRAEVEFHGEYQQIKGMFRAEYSYINPSEEQPV
NT seq 4134 nt   +upstreamnt  +downstreamnt
atgggaactctgatctggttctttctggttccaagcctgataaaaacaacagctctactg
atttcacaatgcactttgcagaaggattttttagagtctctgaaacctcaagatttattt
tattattttgatactatttccgttaaatcagtgcctcactttgagctggtgtgggtgaat
tgctcagggaatgagtctttcagagggctatggagatgctcgtttcagagtgatggagag
agctttgagctgggccaacacagagatgaacaacccgtgtcctgtcccacgagtctggag
acggtgatcaactcaacggtcagcgtgatgaagaaaagggaggatatgtgctgcgagcag
ctgaagttactgagaccagcgcatacgagaactcttctccccatctgccatggcaaatta
caaggtctgattcagtcagggaaaaagaggctgaatattcgaccggtccatcaaaaacac
atagaccatctgaaggagcttactatggatttaccttctggtgtacctcacctgctatta
acccacacattaccagtgaggacacgtcttaaacagcctaagagtcagttcaggttacgg
aggacacctctggggtcagaggtcacacatctggagctagcagtggtggtgggtccagat
gtctatgatgctcataggcaagatactgagagatacatcctaaccaacctcaacatcgcc
tctgagcttcttagagatgttactctcggtgccaatataagagttcatcttgtccgtatg
gtcattctcacagagccaaagccagacatccagatctccgaaaacatcacttcttctcta
aaaagtgtgtgcgagtggggtcagaaggtcaaccctgatgctgacactgaccctttacat
gcagatctgctgttatacattaccaggtttgatctggtgttacccaaagggaataagctt
gtgagaggtgtgacccagctgggcggagtctgttcctctcagtggaactgtgtgattaca
gaggatacaggctttgatcttggcatcaccatcgctcatgagattggccacagttttggc
ataaatcatgatggaatagacaacacatgcagctccagtgggtttatgatggcatctgat
ggaggttataacagtgttgatctcacatggtcccagtgcagcagagctcagctccacaac
ttcttcagtgctgggaaggcggagtgtgtgaaggatgtgccggtgctgggcgcttcagtg
caggactggaggcctggtctcttctatggagtggatgatcagtgccgtatagcgtttggc
agctcggctactgcttgctctttcactaatggtgatatggcaacctgtcgtgttttgtcc
tgccatatcaaccctcgggaccgtagctcatgcactcgtctccttgttccactcttggac
gggacggagtgtgggcccagtcagtggtgtttgaagggccggtgtgtgtctccttctact
ttgggttcctccatgatggttcacggctcatggtcttcatggtctgaattgtctgtctgc
tcaagaacatgtggaggaggaatcacttaccgcaggagacagtgcaacaaccccaggcca
gcctttagtggtaccgtgtgtaaaggacaggacacagaagctgaactttgtaatcggcag
tcctgtgagtcgactcagctggagttcatgtctcagcagtgctcagccacagaccagcag
cctctgtcggtgtctccagactccagctcagtctacacctggatccccgctgtcggctac
agcgcaggtgatgctcagtgtaaactattgtgtcgctcacgtgagcaggacttcatggtg
agtcgtgggtctcagttcatcgatgggacgcggtgtgaagctggtcatactgtaccacgt
ggttccatttctgcctgtctgggtggaaagtgccagctgtttggctgtgatggagtaatg
cattctgggaagatggaggatgtgtgtggggtgtgtgggggtaatggctccacctgtcag
ttcatctcaaacacctattcaggcggagaagttggagagtatgtcacattcctcagtctt
cctctgaacgcctctcaggtgcatgtgattaacacgaagccggtttttacacaccttgcg
gtgttatcaaatgataaatatggcgtgggagagcgagtgcgctctgtcacatgtgttcag
aagcagggtatggtgaaagtagagctgcctgactcagactgtatgcttgactcgaaaccc
caaactactgagacctgcaacccccaaatctgtcctgccagatggcaggtgtctgagcct
ggcgagtgttcggctgtgtgtggacccggggaggctcagagaacagtgtcgtgtatccgc
tcccatcatgaatcggattctgaggttgaccaaaacctgtgccctgaacccaaaccgcga
gaacacgttccctgtgtggtggacgtttgtcctgtcggctgggattcccaaagagagctg
atccgtacagacacccacgtaatgccccgctccagtatggttccagtttatgtttggagt
cctgtgattggccagtgctcaaagacctgtgggaatggatctcagcaggtttggttctcc
tgtgtggatcaccaatcacgtctagaagtcccagagttcctttgtgatcgtaccaataaa
ccagagatgtacacccagccctgtagcctatcaatatgtcctgctacgtggcgctacata
cagggcccgtgcagtgtgtnnnnnnnnnncctatactgttcccagatggtgcagggagga
gacggaaacacggatctggtggtgggagaatctgcttgtcagtctgtggccagaccttca
gaggtggtggagtgtaatactgaagcctgtcctaccaggtggcaggcgggagagcagggt
gactgttcggtgtcatgcgggatgggtgtagctgtgaggagtgtgcgatgtgttcaatat
gaaggaggtgtagagagggtcgtggaggaggaccggtgtgacccaggaaacaagcctccc
gtcactgcaccatgcttcacacaagtctgttccttccactgggacgtgcatgaatggagt
gagtgctcagtgtcatgtggtgatgggatccagtctcggaccgtgtcctgcatgggccca
tccagccctcttcctgtcagtccctttctttgcctccacttgccaaaacccatcaccatc
caggcctgctatagccctgactgttcctcagctcagacctccacaccagagcccaacagc
actcacatgcagtcagagacccggagaggagaggggacatggagaaccacaccagctcca
gctgtcagaatgatgaagatgaggaagagtttctcagccatcgtgcctacagcagatgtg
atgagaagcaccatgagcacaacagaaccaccacagaccagtttctgtgggcaactcctg
cttcaagactcaggaactatcgatctgcgaaacgtcactcaggccaggtgtatatttact
attggccgacctcttgatgaggttattcagatcaaaatcatatccagcactcttaactgc
cggcagaaggagaatatcgccctgtatgacagactcatcctgatgcgtctctgtgagagg
atgaccagtaaaacgctgaaatcacgatcaaatgtcctactggtgcgtcagagccgcctg
acccccggcaatggagtgctgctattttatcagagcataaagaacaaaaaaagccaccat
ggagagtgtgacgttcagctgttctctccgtctgggctcattgagaatccgatcaagagc
gcagccacctctaacactcagagctgtcgcgtgttcatcgatgctccacctgctttcagg
attcagatcagagcgctttctgtgctcaacaacaccgatacaaactccacatacatactg
attcgggatgtggatgccttaaagacgaccatcttcagagggactcggctcttcctgtgg
agctcctcgggaagcagggctgaagtggaattccatggggagtaccagcaaatcaagggc
atgttcagggcagagtattcatacattaacccttctgaagaacaaccagtgtag

DBGET integrated database retrieval system