KEGG   Sinocyclocheilus grahami: 107548342Help
Entry
107548342         CDS       T04918                                 

Definition
(RefSeq) carnitine O-palmitoyltransferase 1, liver isoform-like
  KO
K08765  carnitine O-palmitoyltransferase 1, liver isoform [EC:2.3.1.21]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh00071  Fatty acid degradation
sgh01212  Fatty acid metabolism
sgh03320  PPAR signaling pathway
sgh04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    107548342
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    107548342
   03320 PPAR signaling pathway
    107548342
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:sgh03029]
    107548342
Enzymes [BR:sgh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     107548342
Mitochondrial biogenesis [BR:sgh03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    107548342
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf CPT_N
Motif
Other DBs
NCBI-GeneID: 107548342
NCBI-ProteinID: XP_016084484
Position
Unknown
AA seq 780 aa AA seqDB search
MAEAHQAVAFQFTITHEGIDLHLSYQALNQIYLSGLRSWKKRISRIKNRIIKGVYPASPS
SWLFVVIAILATMYMQSDPSMGIITKIREHLPLSLSLSAQGQTVLSVLLFSTLLWLSLIL
ALRFCLKLLLSYHQWMFELHGRISTKTKVWATLVRLLSSRKPLLYSYQTSLPHLPVPSIK
DTLERYLESVKPLLDVAGFQRMTRLAAEFEKSLGNRLQKYLKLKALWATNYVSDWWEEYV
YLRSRSPIMVNSNYYGMDFLYVTPTATQAARAGNTITALFLYRRKVNREELNPSRIPGTV
IPLCAAQCERMFNTTRTPGEETDVLQHWQDSEFVAVYHRGRYFRLWVYRAGRLLSPREIQ
YQIQRILDDPSPPSPGEDKLGALTAGNRMPWAQVRKQFFSSGVNKRSLDCIEKAAFFVTL
DDQEEGMMGENPSVNLDRYAKSLLHGKCYDRWFDKSLSVVVYKNGKNGLNAEHSWADAPI
VAHLWEFTLATDAFHLGYTADGNCRGEIEHSLPPPQRLSWDIPLQVQTHVSESLAVAQAL
ADDVDCHVFPFREFGKGCIKKMKMSPDSFVQLALQLAYYRDRGTFCLTYEASMTRLFREG
RTETVRSSSNESCAFVLALEAGEDREHCRKLFRKAAEKHQNLYRLAMTGSGIDRHLFCLY
VVSKYLGVESPFLKEVLSEPWRLSTSQTPVQQMELFDLVNHPEFISLGGGFGPVADDGYG
VSYIIMGEEMINFHVSCKHSCTETDSHKFGSQISQAMMDLMTLLNPDFKEATKANPDKQS
NT seq 2343 nt NT seq  +upstreamnt  +downstreamnt
atggcagaggctcaccaggcagtagcttttcagttcaccatcactcatgaggggattgac
ctgcatctgtcctatcaggccctcaatcaaatctacctctccggactgcgatcctggaag
aaacgcatcagtaggattaagaacagaatcattaaaggtgtatacccagctagcccctcc
tcttggctttttgttgtcatagcaatcctggccactatgtacatgcagtctgatccatct
atgggcatcattactaagattcgggagcacctcccccttagtctgtcattgagtgctcaa
ggtcagactgtcctatcagtgctgctgttcagtactctgctgtggttgtctctcattctg
gctctgaggttctgcctaaagcttctcctatcataccatcaatggatgtttgaactacat
ggacgtatttctaccaagaccaaagtctgggcgaccctagttaggttgctgtccagtaga
aagccattactgtacagctatcagacatctttaccacacctgcctgtaccttccattaaa
gacacattggaaagatatcttgagtcagtgaagccactgctagatgtggctggttttcag
cgaatgacaagactggctgctgagtttgagaaaagtctgggtaaccgcctacaaaaatac
ctcaaacttaaagcactgtgggccacaaactatgttagtgactggtgggaagagtatgtt
tatctccggagccggagtcccattatggtcaatagtaactattatggcatggattttctg
tatgtgacacccacggctactcaggcagctcgagcagggaatactatcacagccctgttc
ctatatcgccgcaaagtcaaccgagaggagctcaatcctagtcgtattcctggtacagtc
atacctctgtgtgcagctcagtgtgaacgcatgttcaacaccacacgcacgcctggagag
gagacggatgtgctgcagcattggcaggacagtgagtttgtcgccgtgtaccacaggggc
cggtatttcaggttatgggtttaccgagcaggacgcctgctgtcacccagagagatccag
tatcagattcaaaggatcttggatgacccctcacctccttctccaggagaggacaaactc
ggggcactgacagcaggaaacaggatgccctgggctcaggtgaggaagcagttcttcagc
tctggagttaacaagcgctcactggactgcattgagaaagcggccttctttgtcacgcta
gatgatcaggaagaaggcatgatgggggaaaatccctccgtgaacttggaccgctatgca
aaatccctccttcacggaaaatgctatgacaggtggtttgataagtcattgtctgtcgtg
gtgtataagaatggaaagaatgggttgaatgcagaacattcttgggccgatgctcctata
gtggcccacctgtgggagttcactctggccacagacgcatttcatttgggttacaccgcg
gatggaaattgcaggggagagattgagcactccttaccacctcctcaacggttgagttgg
gacataccgctgcaggttcagacgcatgtgtccgagtctcttgctgttgcgcaggcactg
gctgatgatgtggactgtcatgtgtttcccttcagagagtttgggaaaggctgcatcaag
aaaatgaaaatgagcccagattcctttgtgcagctggccttgcagctggcctactatagg
gatagagggactttctgtctgacttatgaagcctccatgactcgtctgtttcgtgagggt
cgcactgagaccgtacgatccagctccaatgaaagctgtgcctttgtcctcgcactggaa
gcaggagaggacagagaacattgccgcaagctgttccgaaaggctgctgagaagcatcag
aacctctaccgtctggccatgactggatctggcattgacaggcacctcttttgcctatat
gtggtctcaaaatacctgggggtagagtctcctttccttaaagaggtgttgtcagagccc
tggcgcctctccacctctcagacccctgtgcaacagatggagctgtttgatttggtcaac
catcctgagttcatctcgctgggaggaggatttggtccggtggctgatgatggctatggt
gtatcttacatcattatgggcgaggaaatgattaacttccatgtgtcctgcaagcactcc
tgcacagagactgactctcataagtttgggtctcaaatcagtcaagccatgatggatctt
atgactctgctgaacccagacttcaaggaagccacaaaagccaaccctgacaaacagtca
taa

DBGET integrated database retrieval system