KEGG   Sinocyclocheilus grahami: 107548864
Entry
107548864         CDS       T04918                                 

Definition
(RefSeq) delta(14)-sterol reductase-like
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh00100  Steroid biosynthesis
sgh01100  Metabolic pathways
Module
sgh_M00101  Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    107548864
Enzymes [BR:sgh01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     107548864
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 ICMT PEMT
Other DBs
NCBI-GeneID: 107548864
NCBI-ProteinID: XP_016085184
UniProt: A0A672K473
Position
Unknown
AA seq 421 aa
MKPNKHKATHSAEREFGGALGATCIPVFLPLTVLYLLSVCRSPAASVLQWPPPLPPAAHL
WDPLAAVLIVGWITLQSFLYLLPIGKVSEGLVLRDGSRLKYAINGFHALSITAVLLLVCL
WLGMPLGYLFELILPLAVCAIGVSYLLSMYLYIRSFWAPQHALSLGGNTGNPLYDFFMGR
ELNPRIGDFDLKYFCELRPGLIGWVVINLGMLMKEVDLRGSPSLAMLLVNGFQLLYVTDA
LWNEEAVLTTMDIVHDGFGFMLAFGDLAWVPFTYGLQAMFLVVHPQSLSTLGAAGIILLN
GIGYYIFRKSNSQKNQFRRDPTNKSVSQLETIATATGKRLLVSGWWGFVRHPNYLGDLLM
ALAWSLPCGMLHILPYFYVIYFTILLIHREARDEKQCRAKYGLAWDTYCRRVPYRIIPYI
Y
NT seq 1266 nt   +upstreamnt  +downstreamnt
atgaagcctaacaagcacaaagcaacacattcagctgaaagggaatttggaggtgctctt
ggtgccacctgcatccctgtgttcctgcctctgacggttctgtacctgctgagtgtgtgt
cggtctccagcagccagtgtcctgcagtggcctcctcctttaccccccgcagcacactta
tgggaccctttggccgcagttctgattgtaggttggatcaccctgcagagttttctctat
ctactgcccatagggaaggtttctgaaggattagtcctcagagatggatccagactgaaa
tatgccattaatggtttccatgccctgagcattactgctgtcctgttgctagtatgtctt
tggctgggaatgccactcgggtatctgtttgagctgattttgcctctggctgtatgtgcc
atcggtgtgtcctacctgctgtctatgtacctgtatatccgctctttctgggcacctcag
catgctttatcacttggaggaaacacgggaaatcctctgtatgacttcttcatgggccga
gagctcaaccctcggattggagatttcgacttgaaatatttttgtgaactaagacctgga
ttaataggctgggtggtaataaacctggggatgttaatgaaagaagtagacctgagaggc
tctccatctcttgccatgctgcttgtcaacggcttccagctcctctatgtgacagatgct
ctgtggaatgaagaggctgtgcttactactatggacattgtgcatgatggatttgggttc
atgttggcgtttggcgacctggcttgggttcccttcacgtatggtcttcaggccatgttt
ctggttgtgcacccacagtcacttagtactcttggagcagcggggattattcttctaaat
ggaattggttattacattttccggaaatccaactctcagaaaaatcagttcagaagagac
cccacaaataaaagtgtatcgcagctggaaactatcgccactgcaacaggaaagcgtctc
ttggtttcagggtggtgggggtttgtcaggcatccaaactacctgggggaccttctcatg
gctctggcgtggtccctgccttgtggaatgttgcatattctgccttacttctatgtcata
tatttcaccattctgctcatccaccgagaggccagagatgagaaacaatgcagagccaaa
tacggactggcctgggacacgtactgcagacgagtgccctatagaataatcccgtacatt
tattaa

DBGET integrated database retrieval system