KEGG   Sinocyclocheilus grahami: 107549103Help
Entry
107549103         CDS       T04918                                 

Gene name
aldh9a1
Definition
(RefSeq) 4-trimethylaminobutyraldehyde dehydrogenase
  KO
K00149  aldehyde dehydrogenase family 9 member A1 [EC:1.2.1.47 1.2.1.3]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh00010  Glycolysis / Gluconeogenesis
sgh00053  Ascorbate and aldarate metabolism
sgh00071  Fatty acid degradation
sgh00280  Valine, leucine and isoleucine degradation
sgh00310  Lysine degradation
sgh00330  Arginine and proline metabolism
sgh00340  Histidine metabolism
sgh00380  Tryptophan metabolism
sgh00410  beta-Alanine metabolism
sgh00561  Glycerolipid metabolism
sgh00620  Pyruvate metabolism
sgh01100  Metabolic pathways
Module
sgh_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107549103 (aldh9a1)
   00053 Ascorbate and aldarate metabolism
    107549103 (aldh9a1)
   00620 Pyruvate metabolism
    107549103 (aldh9a1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    107549103 (aldh9a1)
   00561 Glycerolipid metabolism
    107549103 (aldh9a1)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    107549103 (aldh9a1)
   00310 Lysine degradation
    107549103 (aldh9a1)
   00330 Arginine and proline metabolism
    107549103 (aldh9a1)
   00340 Histidine metabolism
    107549103 (aldh9a1)
   00380 Tryptophan metabolism
    107549103 (aldh9a1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    107549103 (aldh9a1)
Enzymes [BR:sgh01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     107549103 (aldh9a1)
    1.2.1.47  4-trimethylammoniobutyraldehyde dehydrogenase
     107549103 (aldh9a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 107549103
NCBI-ProteinID: XP_016085540
Position
Unknown
AA seq 508 aa AA seqDB search
MAQQPLLSLPEFQNVSTGALVVKEPLNFWGGARVKPKDTKNSEPVYEPATGRVLCDMIPC
GEEEVDEAIKSAHSAYLKWSKLSGMERARIMLEAARIIRERRDEIARAEVANNGKSITEA
QVDIDVAWQCIEYYAGIAPTLSGQHIQLPGGSFAYTRREPLGVCVGIGAWNYPFQIAAWK
SAPAMACGNAMVFKPSPMTPVTVVMLAEIYKEAGVPDGLFNVVQGGAETGGLLCHHPMVA
KVSFTGSVPTGKKVMEMAAKGVKQVTLELGGKSPLIIFKDCELENAIKGALMANFLTQGE
VCCNGTRVFVQREIMPQFLEEVVKRTKAIAVGDPMCEETRMGALIRKPHMEKVLGFIKQA
KEQGAKVLCGGERFVPSDPKLKDGYFVSPCVLDNCRDDMTCVKEEIFGPVMSVLPFDTED
EVLQRANNTTFGLASGVFTRDIARAHRVAENLQAGTCYINNYNVGPVEVPFGGYKMSGFG
RENGQVTTEYYSQLKTVVVEMGDVESLF
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atggctcagcaaccgcttctgtcgctgcccgagtttcagaacgtttccaccggtgctttg
gtggtgaaggagccgctgaatttctggggaggagcgagagtgaagccgaaggacaccaag
aactctgaaccagtatacgaacctgcaactggtcgtgtgctgtgtgatatgattccctgt
ggagaggaggaggtagatgaggccataaaaagtgctcattctgcatacctaaaatggagc
aaattatcaggaatggagagggcccggatcatgctggaggctgccagaattattagagag
cgcagagatgaaattgctagagcggaagtggccaacaatggcaaatccatcactgaggct
caggtggatattgacgttgcttggcagtgtattgagtactatgctggcattgcccccact
ttgtcaggccagcatatacagcttccaggaggttcttttgcctataccagaagggagcca
cttggagtgtgtgttggcattggagcttggaactacccattccagatagctgcctggaag
tcagccccagctatggcctgtggcaatgccatggtgtttaaaccatctcccatgacccca
gtgaccgtagtcatgttggcagagatctacaaagaggcaggtgtcccagatggactcttt
aatgtggtacaaggaggagccgagactggaggacttctgtgtcaccatcccatggtggcc
aaagtgtccttcactggcagtgtccccactggaaagaaggttatggaaatggcagccaaa
ggtgtgaagcaggtgactctggagcttggaggaaagtcaccactgatcatctttaaggac
tgtgaactggagaatgcgatcaaaggggccctcatggccaacttcctcacccagggagag
gtgtgctgcaatggaacacgggtgtttgtgcagagggagatcatgccacagttcttggag
gaagtggtgaagaggaccaaggccatcgctgttggggatcccatgtgtgaagagacacgc
atgggtgccctcatccgtaaaccccacatggaaaaagtgctgggcttcatcaagcaagca
aaagagcagggtgcaaaggttttatgtgggggagaacgatttgttcccagtgatcccaaa
ctgaaagatggttactttgtgtccccatgtgtgctggacaactgccgggatgatatgacc
tgtgtgaaggaggagatctttggccctgtgatgtctgttctgccttttgacacagaggac
gaagttcttcaaagagccaacaacacaacctttgggttggcatctggagtcttcaccagg
gatatagctcgtgcccacagagttgctgaaaaccttcaggcaggaacatgctacatcaac
aactacaatgttggccctgtggaagttccttttgggggctacaagatgtcagggtttgga
agggagaatggacaagtgaccaccgagtactactctcagctcaagactgttgtggtggaa
atgggagatgtggaaagcctcttttag

DBGET integrated database retrieval system