KEGG   Sinocyclocheilus grahami: 107549235Help
Entry
107549235         CDS       T04918                                 

Definition
(RefSeq) atrial natriuretic peptide receptor 1-like
  KO
K12323  atrial natriuretic peptide receptor A [EC:4.6.1.2]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh00230  Purine metabolism
sgh01100  Metabolic pathways
sgh04270  Vascular smooth muscle contraction
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107549235
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107549235
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sgh01001]
    107549235
Enzymes [BR:sgh01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     107549235
Protein kinases [BR:sgh01001]
 Serine/threonine kinases: Other
  RGC family [OT]
   107549235
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc Pkinase_Tyr Pkinase ANF_receptor HNOBA
Motif
Other DBs
NCBI-GeneID: 107549235
NCBI-ProteinID: XP_016085726
Position
Unknown
AA seq 726 aa AA seqDB search
MFNFTVEDSLMNIISGGFYDGLMLYCSALNDSLAEGHGRPSGESVTKRMWNRTYYGVTGL
VQIDENGDRETDFALWDMTDTNSGNFQIVAVYNGTQKQMKILPGMAIQWPGGNIPWDVPL
CGFKNDNPACRARTITMHQMISIVIFLILVIIFTVTVFIYRKLKLEKELVAQLWRIAWED
IQMSNLEKAMRSTGSKLTLSLRGSNYGSLLTADGNFQMFAKTGYFKGNIVAIKYINRKRI
ELTRKVLFELKHMRDVQNEHLTRFIGACMDPPNICIVTEYCPRGSLQDILENESITLDWM
FKYSLVSDIVKGMAFLHNSVIVSHGNLKSSNCVVDNRFVLKITDYGLSSIRTESDTEDAH
SYYARKLWMAPELLRMECFPPGGTQKGDIYSFGIILQEVALRRGVFYLEVDSLSPKEIVD
RVALGEWPYLRPSVNPQAHSEELGQLMQRCWAEEPSDRPEFNHISVLLRKQNREHRSNIL
DNLLSRMEQYANNLEELVEERTQAYLEEKRKAETLLYQILPHSVAEQLKRGETVQAEAFD
SVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGL
PVRNGKLHGHEIARMSLALLEAVKSFKIRHRPDEQLKLRIGIHSGPVCAGVVGLKMPRYC
LFGDTVNTSSRMESNGESLKIHVSSATRDVLQEFNCFQLELRGDVEMKGKGKMRTYWLLG
EIENGD
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atgtttaacttcacagtggaggattctttgatgaacatcatctcaggtggtttctatgat
ggtctgatgctgtactgcagtgctctaaatgatagtcttgcagaaggacatggtcgacct
tcaggagagtctgtcacaaagagaatgtggaaccggacttattatggtgtcaccggtcta
gtacagattgatgagaatggagacagagaaactgattttgccctgtgggacatgactgac
acgaacagtggtaactttcagattgtggcagtgtataatggcacacagaagcagatgaag
attcttcctgggatggctatccagtggccaggtggcaacattccctgggatgtgcccctc
tgcggctttaagaacgacaaccctgcctgtcgtgcacgaaccatcacaatgcaccagatg
atttccattgtgattttcctcatcctcgtcatcatcttcactgtgactgtgtttatatac
agaaagctgaagctggagaaggagttggtcgctcagttatggagaattgcttgggaggac
attcagatgagcaatctggaaaaggccatgaggagcaccgggagcaaactcacactttct
ctaagaggttcaaactatggatcactgctgacagctgacggtaatttccagatgtttgct
aagactggctactttaagggaaacattgtggccattaaatacatcaacagaaagcgcatc
gagttaacgaggaaagtgttgtttgaactgaagcatatgagagatgtgcagaatgagcat
ttgacccgttttatcggtgcctgcatggatccacccaacatctgcatcgtcacagaatac
tgccctcgaggcagcctgcaggacattttggagaatgaaagcatcacattagactggatg
ttcaaatattcactagtcagcgacatagtaaagggcatggctttccttcacaacagtgtg
attgtatcccatggcaacctgaaatcatccaactgtgtggttgacaatcgttttgtgcta
aagatcactgactatgggctgtccagtatcaggacagagtcagacacggaggacgcccac
tcttattatgcacgtaagctgtggatggctccagagctgttgagaatggagtgctttcct
ccaggaggcacacagaagggcgacatctacagttttggcattatccttcaagaggtggct
ctgcggagaggagtcttttacctggaggtagactcgcttagcccaaaagagattgtggac
cgtgtagctctgggagaatggccgtatctacggccatccgtgaaccctcaagcccacagt
gaagagctgggtcagctgatgcagcgctgttgggccgaagaaccatcagacagaccggag
tttaaccatattagtgtgttactccgcaaacagaacagggagcacagaagtaatatcttg
gataatctcttgtctcgcatggagcagtatgctaataatctggaagagctggtggaggag
aggactcaagcctatctggaggagaaacgcaaggcagaaactttactgtatcagatcctc
cctcattcagtggcagagcagctgaagaggggtgagacggtgcaggccgaagcttttgac
tctgtcaccatctacttcagtgatattgtgggcttcacggctctgtcggcagagagcaca
cctatgcaggtcgtcaccctcctcaatgatctctacacctgctttgatgccattatagat
aattttgacgtttacaaggtggagacaataggcgatgcctacatggtggtttcaggattg
ccggtacggaacgggaaactgcatggtcatgagatcgcacgcatgtcccttgctctattg
gaggctgtcaaatcatttaagattcgccaccgacctgatgagcaactgaaattacgaatc
ggcattcacagtggtcctgtgtgtgcaggtgtagtcgggctgaagatgcctcggtactgt
ctttttggagatacagtgaacacatcttctcgtatggagtcgaatggagaatctctgaaa
attcatgtgtcatcagccactcgagatgtgctgcaggagttcaactgcttccagctggag
ctgagaggagatgtggagatgaagggaaaaggaaagatgaggacctactggcttctgggg
gaaatagagaacggtgattga

DBGET integrated database retrieval system