KEGG   Sinocyclocheilus grahami: 107550873Help
Entry
107550873         CDS       T04918                                 

Definition
(RefSeq) dihydropteridine reductase-like isoform X1
  KO
K00357  dihydropteridine reductase [EC:1.5.1.34]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh00790  Folate biosynthesis
sgh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    107550873
Enzymes [BR:sgh01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.34  6,7-dihydropteridine reductase
     107550873
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 Epimerase
Motif
Other DBs
NCBI-GeneID: 107550873
NCBI-ProteinID: XP_016087765
Position
Unknown
AA seq 237 aa AA seqDB search
MAAANRVLVYGGKGALGSACVHYFKSKGWWVASIDIVANEEANANVLVKLCESFTDQAAQ
VTSDVATLLGEHKVDAIVCVAGGWAGGNSSSKDLYKNSDMMWKQSVWTSTISSHLASLHL
NAGGLLTLSGAKASLEGTPGMVGYGMAKAAVHQLCKSLAGENSGLPSGAVAVAILPVTLD
TPMNRKFMPDADFGSWTPLEYIAETFYSWATGSGRPASGSLIQLVTTGGKTEASAAQ
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atggcagctgcgaaccgtgtccttgtttacggaggaaaaggagctctcggctcggcatgt
gtgcattattttaagtcaaaaggctggtgggttgccagcattgacatcgtagcgaacgaa
gaagcgaacgcaaacgtcctggtgaagctctgcgagtcgttcactgatcaagccgctcag
gtgacgtcggatgtagccacattgctgggggaacacaaggtcgacgccattgtttgtgtg
gcaggaggatgggccggaggaaacagtagctcaaaagacttgtataagaactctgatatg
atgtggaaacagagtgtttggacctccaccatttccagtcatcttgcatcgctccatctg
aatgcaggaggcctgctgaccctctctggtgcaaaggcctcactagaaggcactccaggt
atggttgggtacggcatggccaaggctgcagtccatcagctctgcaagagtctggctggc
gagaacagcggtcttccatctggagctgtagctgtggccattcttccggttaccttggat
acaccaatgaacaggaaattcatgcctgatgcagattttgggagctggacaccgctggaa
tacatcgcagaaaccttctacagctgggccactgggtcaggccggccagcctcaggcagc
ctcatacagctggtgactactggggggaaaaccgaggcctcggcggcccagtaa

DBGET integrated database retrieval system