KEGG   Sinocyclocheilus grahami: 107550950Help
Entry
107550950         CDS       T04918                                 

Definition
(RefSeq) MAP kinase-activated protein kinase 2-like isoform X1
  KO
K04443  mitogen-activated protein kinase-activated protein kinase 2 [EC:2.7.11.1]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04010  MAPK signaling pathway
sgh04218  Cellular senescence
sgh04370  VEGF signaling pathway
sgh04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107550950
   04370 VEGF signaling pathway
    107550950
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    107550950
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107550950
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sgh01001]
    107550950
Enzymes [BR:sgh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107550950
Protein kinases [BR:sgh01001]
 Serine/threonine kinases: CAMK group
  MAPKAPK family [OT]
   107550950
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Choline_kinase Kinase-like
Motif
Other DBs
NCBI-GeneID: 107550950
NCBI-ProteinID: XP_016087884
Position
Unknown
AA seq 381 aa AA seqDB search
MLDDTENNNDSVLSNEQQESPHQIIIVPPESTLKIKKKVITEEYKLAGQVLGVGINGKVW
EIFQKKSGKHYALKMLRDTPKARREVELHCRASSCPRIVGMEDVFENYYQGKKCLLLIME
CMEGGELFRHIKERGDQAFTEREASEIMRNIGEAVEFLHGINIAHRDLKPDNLLYSSKHS
DAQLKLTDFGFAKETTSNNCLTTPCYTPYYVAPEVFGPEKYDKSCDMWSLGVIMYILLCG
YPPFYSNHGLPLSPGMKKRIRNGQYEFPNPEWSQVSEEAKQLICQLLKTDPTERMSITQF
MNHSWINKSMNVPPTHLHTSRVLKEESHVWDEVKEEMTNALATIRVDYEQIKVKPIKDAS
NPLLLKRRKKMAAAVKEAPGP
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgttagatgatacagaaaataacaatgattcagtgctttccaatgagcagcaagagagt
ccgcatcagattatcattgtgcctccagagtcgacactgaagataaagaagaaagtaata
acagaggagtataagcttgcaggacaagtgctcggggtaggcatcaacggcaaggtctgg
gaaatattccagaagaaaagtggcaaacattatgccttaaagatgttgcgggacacccct
aaggctcgacgggaagtggagcttcactgcagggcatcgagctgcccccgtatcgtagga
atggaagatgtctttgagaattactaccaaggcaaaaagtgtttgcttctgatcatggag
tgtatggaggggggagaactctttcgccacattaaagaacgtggtgatcaagctttcact
gaaagagaagcctcggaaataatgagaaatataggagaagctgtggagtttctgcatggt
attaacattgctcacagagatctcaagccagataatttactgtactcttcaaagcattcg
gatgcccagctcaagcttacagactttggatttgccaaagagaccacatccaacaactgc
ttgaccaccccgtgctatacaccttattatgtggccccagaggtgtttggtccagagaaa
tatgataagtcatgtgacatgtggtcattaggagtcatcatgtacatcttgttgtgtgga
tatccaccattttactcaaaccacggcttaccgctctcaccgggaatgaaaaaacgcata
aggaatggccagtatgaatttccaaaccctgaatggtcacaggtgtcggaggaagcaaag
cagctcatttgccagctattgaaaacagatcctactgagagaatgagcatcacacaattc
atgaaccattcttggatcaataagtcaatgaatgttcctccaacacatctacacacaagt
cgagttcttaaggaagagagtcacgtctgggatgaagtcaaggaagagatgactaatgcc
ttagcaacaataagagtggactatgaacaaataaaggttaaaccgattaaggatgcgtcc
aatcctcttcttctaaaaagaagaaagaaaatggctgctgcagtgaaagaagcaccaggg
ccgtga

DBGET integrated database retrieval system