KEGG   Sinocyclocheilus grahami: 107551872Help
Entry
107551872         CDS       T04918                                 

Definition
(RefSeq) autophagy-related protein 16-1-like isoform X1
  KO
K17890  autophagy-related protein 16-1
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04136  Autophagy - other
sgh04140  Autophagy - animal
sgh04621  NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107551872
   04136 Autophagy - other
    107551872
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    107551872
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sgh04131]
    107551872
   03029 Mitochondrial biogenesis [BR:sgh03029]
    107551872
Membrane trafficking [BR:sgh04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    107551872
 Others
  Rab GTPases of specific organelles
   Auto phagosome
    107551872
Mitochondrial biogenesis [BR:sgh03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    107551872
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATG16 WD40 ANAPC4_WD40 eIF2A Ge1_WD40 Nup160 KASH_CCD DUF4472
Motif
Other DBs
NCBI-GeneID: 107551872
NCBI-ProteinID: XP_016089113
Position
Unknown
AA seq 651 aa AA seqDB search
MTRSALISRNNYFYRQEESSGDAFRRCEEQMAGRRVECLWKRHVVEQLKQRDRVQRQAFE
EIIHQYNRLLEKSDLQVVFSERLQTEKYEQQNRHDLSPGVEGGRSDSLQQEMAQMRIKHQ
EELTELHKKRGELAQSVIELNNQIQQKDKEIQSNEAKMLEYQQQISRLEGECRELRNSLS
DLERANQTLRDEYDALQITFSALEEKLRKTTEDNQELVTRWMAEKAQEANKLNAENEKDS
RRRQAKLQKELADAAKEPLPIDPDDDIEVLSEDAVKGTGETSPSRQTSRAPSRRVSQPPP
PAGLLDSFSNIFGLSDSVQPGFVPSDSRRRRSVNSFGSSPESAEVPSACADVRVPSTALH
VFDAHDGEVNAVRFSPGSRLLATGGMDRRVKLWEVVSGRCEPKGVLTGSNAGITSIEFDS
AGSYLLAASNDFASRIWTVDDYRLRHTLTGHSGKVLSARFLLDNARIVSGSYDRTLKLWD
LRSKVCMKTVFAGSSCNDIVCTEQCVMSGHFDKKVRFWDIRAESIVHELELLGRVTSLDL
NHDRTELLSCSRDDLVKIIDLRSNAVRQTFDAQGFKCGSDFTRVTFSPDGSYVAAGSADG
VLYIWNVLTGKLDKTLDKGHSSAINSVSWSPSGAYVASVEKGSKAVLWSDM
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgacacggtcggctcttattagtcggaataattatttttatcgtcaagaagagtccagc
ggagacgcgtttagacgctgtgaggagcagatggcgggacgtagagtcgagtgtttgtgg
aaacgtcacgtcgtggagcagctgaagcagagagaccgagttcagcgtcaggccttcgag
gaaatcatacaccagtataaccggttgttagagaagtctgatcttcaggttgttttttct
gaacgtctccagaccgagaaatatgagcaacagaacagacacgacctcagtccgggcgtc
gagggcggccgcagtgattccctgcagcaggaaatggctcagatgagaatcaaacatcaa
gaggagctgacagagctgcacaagaaacgaggagagttggcccagagcgtgattgaacta
aacaaccagattcagcagaaagacaaagagatccagagtaatgaagccaagatgctggag
tatcagcagcagatctcccgtctggaaggagagtgtcgtgagctgcgcaactctctgtcc
gatctggaacgagccaatcagacgctgcgagacgagtacgatgccctgcagatcacgttc
agcgccctggaggagaaactacggaaaaccacagaggacaatcaggagctggtgacacgc
tggatggccgagaaagcgcaggaggccaacaaactcaacgctgagaacgagaaggactcc
aggcgcagacaagcgaagcttcagaaggaactggcggacgcagcgaaggaacctcttccc
atagacccagatgatgacatcgaagttctctcagaggatgctgtgaagggaacgggtgaa
acgtcaccgagcagacagaccagtcgtgcacccagtagacgagtgtctcagcctcctcct
cctgctggactgctggattccttctctaatatctttggcttgtctgattctgtccaacct
ggtttcgtcccatctgactccagaaggcgtcgctcggtgaactcgttcggctcgtctcct
gaaagcgctgaggtgccgtcggcctgcgctgatgtccgagttccctccactgcgctgcac
gtctttgacgcccacgatggagaagtgaacgccgtgaggttcagtcccggttcccgtctg
cttgccacgggaggaatggaccgcagggtgaagctctgggaggtcgtttctgggcgatgt
gaacctaaaggtgtgctgacgggcagtaatgctggaatcaccagcatagagtttgatagt
gcgggctcgtatctactggctgcgtcgaatgatttcgccagcagaatctggactgttgat
gactacagactgcggcacacactcacagggcacagcgggaaggttttatccgctcggttt
ctcctcgataacgctcggatcgtctccggcagctacgaccgaacgctcaagctctgggac
ttacgcagcaaagtctgcatgaagacggtgtttgctggttctagctgtaatgacatcgtc
tgcacggagcagtgtgtgatgagcggacacttcgataagaaagttcgtttctgggacatc
agggcggagagtatcgtgcatgagctggagttgctgggacgcgttacctctttggacctc
aatcacgaccggaccgagctgctgagctgctctcgtgacgacctggtgaagatcatcgat
ctgcgcagtaatgcagtgcgacagacgtttgatgctcaaggtttcaagtgtggttcagac
ttcaccagggtcacgttcagtcctgatggaagttacgtggcggccggttctgcagacggc
gttctgtacatttggaacgttctgacggggaaactagacaaaacccttgataagggtcac
agttctgccattaattcggtgtcctggtctccatcgggcgcgtacgtggccagtgttgag
aaaggcagcaaggctgtgctctggtctgacatgtga

DBGET integrated database retrieval system