KEGG   Sinocyclocheilus grahami: 107552158
Entry
107552158         CDS       T04918                                 

Definition
(RefSeq) acid-sensing ion channel 1-like
  KO
K04829  acid-sensing ion channel 1
Organism
sgh  Sinocyclocheilus grahami
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:sgh04040]
    107552158
Ion channels [BR:sgh04040]
 Ligand-gated channels
  Acid-sensing ion channel (ASIC)
   107552158
SSDB
Motif
Pfam: ASC
Other DBs
NCBI-GeneID: 107552158
NCBI-ProteinID: XP_016089473
Position
Unknown
AA seq 477 aa
MKTSVMDLKVEPMDIDYDQPPPLQVFAHTSTLHGISHIFSYEKITAKCCLWVVFFLSSLT
FLMYVCVDRIQFYLEYPHVTKLDEITTPMMVFPAVTICNLNSIRFSRITRNDLYHAGELL
ALLNSRHEIRDAHLVEESVMEVLKSKADFRSFKPRPFNMWEFYNRTGHDIKDMLLSCQFR
GSPCRPEDFSVVFTRYGKCYSFNSGNTGAPLVSVKGGMGNGLEIMLDIQQDEYLPVWGET
DDSSFEAGIKVQIHSQDEPAFIDQLGFGVAPGFQTFVSCQEQRLVYLPAPWGSCKSTPPS
SDYFKAYSISACRTDCETRYLVENCNCRMVHMPARIPVTTVCCACSKRQKCWIMCHFSIL
MYNLPYWTVKIMLNRVLCAVRENVLVLDVFFEALNYETIEQRKAYEVAGLLGDIGGQMGL
FIGASVLTILELFDYLYEVMKHRLCRCSDKKHHHNNNTDHGTVLGLDDVKCHVSKFH
NT seq 1434 nt   +upstreamnt  +downstreamnt
atgaaaacatcagtgatggatctcaaagtggaacctatggacattgattacgaccagccg
cctcccctccaagtgttcgctcacacctcgactctacacggcatctctcatatcttctcc
tatgagaagatcacggccaaatgctgcctctgggtggtgtttttcctcagctcactgacc
tttctcatgtacgtctgcgtcgatcgcattcagttctacctggagtaccctcacgtcacc
aagctggacgagatcacgacgcccatgatggttttcccagcggtgacgatttgcaatctc
aactccatccgcttcagcaggatcacacgcaacgacctgtatcacgcgggcgagctgctg
gcgctgctcaactccagacatgagattcgggacgctcacctagttgaagaaagcgtgatg
gaggttctcaagagcaaagcagactttcgctccttcaagccgcgacccttcaacatgtgg
gagttctataatagaacaggacatgacataaaagacatgctgctctcctgccagttcaga
ggttctccgtgtcgacccgaagacttcagcgtggtattcacacgttacgggaaatgttac
agcttcaactcgggtaacaccggcgcgccgctggtcagcgtgaagggagggatgggaaac
ggcctggagatcatgctggacattcagcaggacgaatatttacctgtgtggggagagaca
gacgactcgtcgtttgaggcgggaatcaaagttcagattcacagtcaggacgagcctgca
tttatagatcagctgggcttcggagtcgcaccaggattccagacgttcgtttcttgccaa
gagcagcgactggtgtatcttcctgctccatggggcagctgcaagtcaaccccgccgagc
tcggattacttcaaagcgtacagcatcagcgcctgtcgaacagactgcgagacgcgctac
ctggtggaaaactgcaactgccgtatggtgcatatgcctgcccgcataccagtgactaca
gtgtgctgtgcatgttcaaaaagacaaaagtgttggataatgtgtcactttagcatttta
atgtataatcttccatactggactgtcaaaatcatgctaaaccgggttttgtgtgctgtc
agggagaatgttctagtgctggacgtgttctttgaggctctgaactatgaaaccattgag
caaaggaaagcctatgaggtggctggtctgttgggtgatatcggaggacagatggggctg
ttcattggagccagtgttcttacgattttggagctttttgactacctttatgaggtaatg
aaacacaggttgtgccgctgctccgacaagaaacatcaccacaacaacaacactgatcac
ggcactgtactcggcctggatgatgttaaatgtcacgtcagtaaattccattaa

DBGET integrated database retrieval system