KEGG   Sinocyclocheilus grahami: 107552187Help
Entry
107552187         CDS       T04918                                 

Definition
(RefSeq) myotubularin-related protein 3-like isoform X1
  KO
K18082  myotubularin-related protein 3/4 [EC:3.1.3.48 3.1.3.64 3.1.3.95]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh00562  Inositol phosphate metabolism
sgh01100  Metabolic pathways
sgh04070  Phosphatidylinositol signaling system
sgh04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    107552187
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    107552187
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107552187
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sgh01009]
    107552187
Enzymes [BR:sgh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     107552187
    3.1.3.64  phosphatidylinositol-3-phosphatase
     107552187
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     107552187
Protein phosphatases and associated proteins [BR:sgh01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    107552187
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myotub-related FYVE Y_phosphatase Y_phosphatase3 DSPc
Motif
Other DBs
NCBI-GeneID: 107552187
NCBI-ProteinID: XP_016089517
Position
Unknown
AA seq 1051 aa AA seqDB search
MFQMHITCKDCKVIRCQFSTFEQCQEWLKRLNAAVRPPSQIEELFSFAFHAWCVEKEQHG
DLCRPGDHVMSRSHNEVERMGFDTQNAWRVSEINNKYKLCSSYPELLLVPAWITDKELEN
VAAFRSWKRIPAVVYRHQSTGAVIARCGQPEVSWWGWRNADDEHLVQSIARACAVDSSSC
KGVSNGSFSREYTNGADLSDVDFDSSMTNSSEVETLAIQPRKLLILDARSYAAAVANRAK
GGGCECPEYYPNCEVVFMGMANIHSIRKSFQSLRFLCTQMPDPANWLSALESTKWLQHLS
LLLKASLLVVNAVDRDHRPVLVHCSDGWDRTPQIVALAKLLLDPYYRTIEGFQVLVETEW
LDFGHKFADRCGHGENAEDLNERCPVFLQWLDCVHQLQRQFPCSFEFNEAFLVKLVQHTY
SCLFGTFLCNSGKEREDRHIQERTCSVWSLLRAANRSFRNMLYSSHSETVLHPVCHVRNL
MLWTAVYLPCSSPTTPSDDSCAPYPAPGANPEDQPLGRRPKTRSFDNLPSACDVGNPLTS
NRRSSDPSLNEKWQDHRRSLELNIGTGADGAASPDSDERVNGQTVVGLMGTLPNGGTGNG
DGLGEGVDEAELTVGVAVGQMENILQEATKDESPPDSHRDTKADHTNKTSTLNGQSDDVA
RSEEGSVEAQLTADAQESKAKSLGDANVNGQFSEDGSSEASSALSQETSGSQDLEVVVEK
CAIQEHNPSRNTSNIPPNGLRTVSNGHGRESIEQEKHLSLLESSTETLTEDLGVRPESLG
PLTIPPPLKTLAESSCLKQGLHTSTDPRTLNNTPKRPSLSAFPPSTDLLHPVCNGDSPDP
STPQWAARTNGERATLSRQLSLASCGSLTLHARGACSHHRCLHLGFLGRPSFSPPEPPSA
RSHLDDDGLTLHTDAVQQRLRQIEAGHQLEVEALKRQVQELWSRLESHQAAGMLRLSGDM
GDEVTSIADSDFNLEPNCLSRCSTELFSEASWEQVDKQDTEVTRWYPDHLAAQCYGCERG
FWLATRKHHCSKSAWAVFCPDLKKPLPHLTL
NT seq 3156 nt NT seq  +upstreamnt  +downstreamnt
atgttccaaatgcacatcacctgcaaagactgcaaggtcatcaggtgtcagttttccacg
tttgagcagtgtcaggagtggctgaagaggctgaacgctgcagtccgtcccccgtcccag
atagaggagctcttttccttcgccttccacgcgtggtgcgtggagaaggagcagcatggg
gatctgtgtaggccaggtgatcacgtgatgtcacgttcccataacgaggtggagcggatg
ggctttgacactcagaacgcctggagagtgtctgagatcaacaataagtacaagttgtgc
tccagctaccctgagctgctgctggtgccagcctggattactgataaggagctggagaat
gtggcggccttccgctcctggaagaggattccggccgtggtttacaggcaccagagcaca
ggggcagtgatcgctcgctgtggtcagcctgaggtcagctggtggggctggaggaacgca
gatgatgagcacctggtgcagtccatcgccagagcctgtgctgtggacagcagctcctgt
aaaggcgtctccaacggctccttctcccgcgagtacactaacggagccgatctctccgat
gtggacttcgactcgtctatgactaacagctcagaggtggagacactggccatccaacct
cgaaagcttctgatcctggacgctaggtcatacgccgctgccgtagccaaccgagccaaa
ggaggagggtgtgaatgcccagagtactaccctaactgtgaggtggtgtttatgggtatg
gccaacatccattccatccgcaagagtttccagtctctgcgcttcctctgcacacaaatg
cctgatccagccaactggctgtctgctctagagagcacaaagtggctgcagcatctgtcc
ctcctgctcaaggcatctctcctcgttgtgaacgccgtggaccgcgaccacaggcccgtg
ctggtgcactgctcagatggctgggatcgcacccctcagatagtggcgctggccaaactc
ctgctggacccgtactaccgcaccattgagggttttcaggtgctggttgagaccgagtgg
ttggacttcggtcataagttcgcagaccgctgtggtcacggagaaaatgcggaggacttg
aacgagagatgtcctgtcttcctgcagtggttagactgtgtgcaccagctccagagacaa
ttcccatgttccttcgagttcaacgaagcctttctggtgaagctagtgcagcacacatac
tcgtgtctgttcgggacgttcctgtgtaacagcgggaaggagagagaggacagacacatt
caggaaagaacctgctccgtttggtctctcctcagagccgccaaccgctccttcagaaac
atgctgtactcctctcattcagagaccgtgcttcatcctgtgtgtcacgtacgcaatctc
atgttgtggacagcagtttacctaccctgctcttcacccacaaccccttcagatgactcc
tgtgccccctacccagcacctggtgccaaccctgaggaccagcccctcggcaggcgtcct
aaaacccgctcgttcgataacctgcccagcgcttgtgatgtcggaaacccgctgacctcc
aatcgacgttccagcgaccccagtttgaatgagaaatggcaggaccatcgcaggtctctg
gagctcaacatcgggacaggagctgatggtgctgcatctccagactcagatgagagggtc
aacggacaaaccgtggtggggcttatgggaacattacctaatgggggcacagggaatggg
gacggtctcggggaaggcgtcgacgaggcagagctgacagttggtgtggctgtgggccaa
atggagaacattcttcaggaagctacaaaagacgaatcgccaccagatagccacagagac
acaaaggcagaccacactaacaaaacctccactctaaacggacagagtgatgatgttgca
cgttcagaagagggcagtgttgaggcacaactaactgctgatgctcaggagagcaaagct
aaaagccttggagatgcaaatgtcaatggacaattttcagaagacggtagttctgaagca
tcttctgctctcagccaggaaacctcgggaagccaagacttagaagtagtagtcgagaaa
tgtgcgatacaagaacacaatccttctcgtaacacaagtaatatccctcccaatggcctc
aggactgtgagtaacggccatgggcgagaaagcattgagcaggagaaacatctttctctt
ttggagagctccacagagacgcttacggaggacttgggcgttcggcctgagagtctggga
cctttaaccattccacctcctcttaaaacccttgccgaatcatcgtgcctcaaacagggt
ctccacacctcaaccgaccccaggactttaaacaacacccccaaacggccatctctcagt
gcctttcctccctccactgacctcctccacccggtgtgcaacggagattcccccgaccca
tccacgccgcaatgggcggcgcgcacaaatggggaacgggccacgctcagccgtcagctg
tcgctcgccagctgcggctcgctgactctccacgcacggggcgcctgctcccaccatcgc
tgcctgcacttggggtttctgggccggccgagcttcagccccccagaacccccttcggcc
cggagccatctggacgatgacgggttgaccctgcacacggacgcagtgcagcagcggctg
cggcagatcgaggccggtcaccagctggaggtggaagctctgaagaggcaggtacaggag
ctctggagccgtctggagagccaccaggccgccgggatgctgcgactcagcggagacatg
ggtgatgaagtgacctcaatcgcagactccgacttcaacctggagcccaactgtctgtcc
cgctgcagcactgaactcttctctgaggccagctgggagcaggtggacaagcaggacact
gaggtgacccggtggtacccggatcatctggctgctcagtgctacggctgtgagagagga
ttctggctggcaactagaaaacatcactgcagtaaatctgcatgggctgtgttttgtcca
gacctgaagaagcccctcccacacttaacactttaa

DBGET integrated database retrieval system