KEGG   Sinocyclocheilus grahami: 107552322Help
Entry
107552322         CDS       T04918                                 

Definition
(RefSeq) poly [ADP-ribose] polymerase 10-like
  KO
K15261  poly [ADP-ribose] polymerase 10/14/15 [EC:2.4.2.30]
Organism
sgh  Sinocyclocheilus grahami
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    107552322
Enzymes [BR:sgh01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     107552322
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PARP WWE UIM DUF2267
Motif
Other DBs
NCBI-GeneID: 107552322
NCBI-ProteinID: XP_016089669
Position
Unknown
AA seq 1069 aa AA seqDB search
MCCETDFILYLSPNKDLVLVHLNKPLDKDFQMLKDEVSKKPLNGAKVTLEQVESTDSILV
ANLSPALTEDVLELYFGSSRAGGADVLAVSMLADGRAKVSFKDVKSVGDVLQKSHRLEGT
DLVVEPYFDFLHALEDQSSVSTQDEQGTLTDGNQPQTVSPQSPTASVPVVSASLGHKAAL
TDNATNLATTASVPEPSVQKERVSFVSVLDATKRHLLSLSSLLENLKKDHPKFDVSLAKD
GVQIKGPDQTEVERLKNEVLKFLTGVVEDRLTYDKLKAEFLGREDVKKRLNLSLKSVPST
YSVSGCTVSVMSPSRSAVRQARDLIESQISEFTVPIAKECESMLSSTEWSDILASLDFCS
AKLSDAGGAITALTLTGMEKDNEEKMVVFLSTPLQRETVLSMEPGMLKFLQLHHQGLLAD
MGEVILFPLETGDGLSIQGEWSVCQSAAELLSAIIGSIFTKTIVVTQPGISRFLMEEEGV
SILGEMTAKFEVYIDMTRVHWEPLEDEDILELAWKMTTCQNFQRSSSANSIQEFTAGVPN
GRNPTDARTSARIEEAKKILAVIGSDLNPQPSSLGATDIESVDLYSDQSRDTSAAAEEED
DQPQSLQAHDLQSSSAPMNACSLDEDASFLLAIQMSMELNQRSDAEDIQKALELSRSDSM
PNQENTQLERAFEMSLQDAIKSANKAEICVFANYNHDLVRVDIALGKKVGLRQCTEKVEN
KNLRKLSSHQKRCIELIKRKHAVEISIQGTTAVLSGFKEYVSEAMMDLKNVLRRTESMMT
DAEIVKTVQWVWVEQGSSSKAIPYPPDATVFIENAWKMKQKKTDILFNNQPCSIDFEKME
EHSLASGKSVPIKRKMLSTEDLYTDGADEDYSLLSSMPEVCPVDVDSDEFQNVVKDFYDT
LQDSHNKIRIIKVDKLMNKLLHDQYRLKKVSIERSSSEAQVERTLYHGTSETSVKEICIQ
GFNRSFCGKNATVYGQGVYFAVNGSLSVSDTYSPPNADGHKFIFVARVLTGDFTVGKYDY
KTAPLKESSGVPVRYHSVTDQINSPTLFVIFNDTQAYPQYLITCKKIYG
NT seq 3210 nt NT seq  +upstreamnt  +downstreamnt
atgtgttgtgaaacagacttcatcctatatctgtctccgaacaaggatctggttctagtg
cacctaaacaaacctttagacaaagattttcagatgcttaaagacgaagtttccaagaag
cctctaaacggagcaaaggtcactctggagcaggtcgaatccacagactccattttggtg
gccaatctgtctcctgcgctcacagaggacgtgctggagctctacttcgggagtagtcgt
gctggaggcgctgatgtcctagcagttagcatgctagctgatggacgtgctaaggtttct
tttaaggatgtgaaatctgtgggcgacgttctccagaaatcccatcgtttggaaggtaca
gatttagtagtggagccgtactttgatttcctgcatgctcttgaggatcagtcatctgtg
agcactcaagatgaacagggaacattgacggatgggaaccaaccacagacggtctcaccc
caaagtccgactgcttctgtcccagtggtgagcgccagcttaggacacaaagctgctctc
acggacaatgccacgaatttagcgactactgcatctgttcctgagccatctgtccagaag
gaacgcgttagcttcgtatctgtgcttgatgccactaaacgtcacctgctcagtttgagt
agtttgctcgagaacctcaaaaaggatcaccccaaatttgacgtcagtctagcaaaagat
ggcgtccaaatcaaagggcctgaccaaactgaggttgaaagacttaaaaacgaagtcctg
aagttcctgactggtgttgtggaggaccgtctgacgtacgacaagctcaaagctgagttt
ctcggacgggaggatgttaagaagaggctgaatttgtctttgaaaagcgtaccttccacc
tacagcgtgtctggctgtacggtctctgtaatgtctccgtcccgtagcgcagtcagacag
gcccgagacctgatagagtcccagatctcagagttcactgtgcccatagccaaagagtgc
gagagcatgctctcttcaacagagtggtctgacatcctggcatctctggacttctgcagt
gccaaactgtccgacgccggtggagcgattactgccctcaccctgacagggatggagaag
gacaatgaagagaagatggttgtgtttctcagcacaccactccagagggagaccgtcctg
tctatggaaccaggaatgctcaagttcctgcaactccatcatcaaggtctgctggcggac
atgggagaggtcatcctattcccactggagactggagacggattgagtattcagggagag
tggagtgtatgccaatcagcggcagagttattaagtgctattatcggatcaatctttaca
aagaccattgtggtgacccagcctggcatttcccgcttcctgatggaggaggagggtgtg
agcatacttggagagatgacagcaaagttcgaagtctatatcgacatgaccagagtgcac
tgggagccgctagaagatgaagacatactggagctggcatggaaaatgacaacctgtcaa
aacttccagagaagttcctctgcaaattccattcaggaattcactgctggagtcccgaat
ggacgtaacccaaccgatgcacgtacttcagctcgtattgaagaagctaagaagatcttg
gcagtcattggcagtgatttgaacccccaaccttctagtttaggagccacagacattgaa
tctgtagatctgtattcagaccagagccgagatacctcagcagcggcagaagaagaggac
gaccaaccccaatcactgcaggcccatgacctccagagctcctctgcacccatgaacgcc
tgcagcctcgacgaagacgcaagcttcttgctggccattcagatgtcaatggagctcaac
caaagatcggacgcagaggacatccagaaagctctagaactgtccaggagcgactccatg
ccaaaccaggagaacacgcagctggagagagcatttgaaatgtccttgcaagacgccatc
aagtcagctaacaaagccgagatctgtgtgtttgctaactacaaccatgatcttgtcagg
gtggacatcgcattgggcaagaaggttggactgagacagtgtacggagaaggtcgagaac
aagaacctgcggaaactctcctcccatcagaagagatgcatagagctcattaagaggaag
catgccgtcgagatcagcatccagggcaccaccgccgtcctctccggctttaaagagtac
gtctctgaggccatgatggacctgaagaacgtcctgagaaggacagagagcatgatgacg
gatgctgaaatcgtgaagaccgtacagtgggtgtgggtcgagcagggctcctcctcgaag
gccatcccgtacccgccggatgccacggtgttcattgagaacgcttggaagatgaagcag
aagaagactgatattctcttcaacaatcagccgtgcagcattgacttcgagaagatggaa
gagcacagtttggcatccgggaaatccgtgcctattaaacggaaaatgctgagcacagag
gacttgtacacggatggtgcagatgaagattacagtctgctgtccagcatgcctgaagtg
tgtcccgtggatgtggattctgatgaattccagaacgtggtcaaagatttctacgacacc
cttcaggacagccacaacaaaatcagaatcattaaggttgataagctgatgaataaactc
ctgcatgaccagtacaggctgaagaaggtcagtattgagcgcagctcctcagaggcgcag
gtggagcgcaccctctaccacggcaccagtgagaccagcgtcaaggagatctgcattcag
ggcttcaacaggagcttctgtgggaaaaacgccactgtgtacggtcagggcgtgtatttt
gcggtgaacggctcactgtccgtgtctgacacctactccccacccaatgcagacgggcac
aagtttatttttgtggccagagtgctgaccggagacttcaccgtgggcaagtacgactat
aaaaccgccccgctgaaggagagctccggcgttcctgtcagataccacagcgtgacggat
cagatcaactccccgacgctgttcgtcatcttcaacgacacacaggcttacccacagtac
ctcatcacatgcaagaagatctacggctaa

DBGET integrated database retrieval system