KEGG   Sinocyclocheilus grahami: 107553182Help
Entry
107553182         CDS       T04918                                 

Definition
(RefSeq) cytosolic phospholipase A2 delta-like
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh00564  Glycerophospholipid metabolism
sgh00565  Ether lipid metabolism
sgh00590  Arachidonic acid metabolism
sgh00591  Linoleic acid metabolism
sgh00592  alpha-Linolenic acid metabolism
sgh01100  Metabolic pathways
sgh04010  MAPK signaling pathway
sgh04217  Necroptosis
sgh04270  Vascular smooth muscle contraction
sgh04370  VEGF signaling pathway
sgh04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    107553182
   00565 Ether lipid metabolism
    107553182
   00590 Arachidonic acid metabolism
    107553182
   00591 Linoleic acid metabolism
    107553182
   00592 alpha-Linolenic acid metabolism
    107553182
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107553182
   04370 VEGF signaling pathway
    107553182
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    107553182
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    107553182
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107553182
Enzymes [BR:sgh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     107553182
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B C2 cPLA2_C2
Motif
Other DBs
NCBI-GeneID: 107553182
NCBI-ProteinID: XP_016090805
Position
Unknown
AA seq 806 aa AA seqDB search
MLKKEFMPYWNLSVTVLQGKFSRSYDLLSKCDCYVVLKLPTACACCHRTKTVKNSDAPKW
NETFRFRVHSGVKNILEFHIFDADKLTKDDYCSTILFDVNNLTPGQKQTKCFITDDKSEL
WVEFEMTVSSEKPEPYFSNGVLMAGLFCALDVKVEKRLRTHAEKDLMLKLRGAYKEDCLI
PGSEENPSCSQTIRYYINRDLETEFSLIPPNAGAEEDGINPKTADILSSVPMKPLAAKPQ
IKLCMPVGQGEVDLQLSTEGRSDEKLDVRLDFDIPMEENNFLVKRQKVVSQALQKALNLS
SAPEPSKVPLVAVVCSGGGTRAMCGTFGGLRALQKLQLLDTVSYITGVSGSTWTMASLYG
DANWSNNDLNGVMESVKKEISKSVFSIFSPEQLRHYKEKMEEREEEGLLVSLIDMWGLAI
EYLIQGKKKMGTLSDQQMALSKGQNPLPIYTALNMKNGKTGCTIETEWCEFTPYEVGFTK
YGVFIPAQNFGSEYYLGHMVKKLPESGIYSLLGIWSSVFSLSLTQLWSRITGVIPSWASK
IGKGVNQTDTDDKSSTSDTLQASPKTDLAKKLSNFLSCRPIISQVFNFLRGFHLHRNYSE
NCDFTSWKDTHPDAFPNSLTPADATLGLVDSAFVIKSGFPPVLRCNRRADVILSLNYAWD
PDHFKVIKQTQEYCAERKIPFPKIDYKKLESEPIREVYVFEDKENPDVPIVIHFPLVNVS
FKQFKSPGVKREGKEEMKDGDFDIDFTSLLSPFSTLNLTYQPEDFQKLTNLTTYNILNNT
DVILNTLNKALKRNMERIPLTKASKF
NT seq 2421 nt NT seq  +upstreamnt  +downstreamnt
atgctgaagaaagagttcatgccgtactggaacctcagtgtcacagtgctgcagggaaaa
ttcagtcggtcgtatgaccttttgtctaaatgtgactgctacgtcgtcttaaagttaccc
acggcctgtgcctgctgccatcgcaccaaaactgtgaaaaacagtgatgcaccaaaatgg
aatgaaacctttcgtttcagagtgcacagcggtgtcaagaacattctggaattccacata
tttgatgctgacaagttaacgaaagatgactactgctccaccatcctattcgacgtcaat
aacctcacacctggacaaaagcaaacaaaatgcttcattacagatgataagagtgagctg
tgggtggagtttgagatgacggtgagctctgagaagcctgaaccgtacttctctaatgga
gtgctgatggcaggtctattctgtgcactggatgttaaggtggaaaagcgtctaaggact
catgctgagaaggacctgatgttaaaactgcgaggcgcatacaaggaagactgtttgatc
ccaggctctgaggaaaaccccagctgctcacagactattcgctactacatcaaccgagac
ctggagactgagtttagtctcatcccaccaaatgctggggcagaagaggacgggataaat
ccaaagactgcagacattctgtcatcagtccctatgaaaccattagcagccaaaccacag
attaaactctgcatgcctgttggacagggtgaagtggatctgcaactaagcacagagggc
cgctctgacgaaaagttggatgtgcgtctggattttgatattccaatggaagaaaataat
tttctggtgaagagacaaaaagtcgtgtcacaagctcttcagaaagctttgaatctcagc
tctgcacctgaacccagcaaggtcccattggtggctgtggtgtgttctggcggcgggacc
agagcgatgtgtggcacatttggaggcctaagagctctgcagaaactccagcttcttgat
acagtcagctacatcacaggggtttctggctctacctggactatggcttctctttatggt
gatgctaactggtcaaacaatgacctaaatggggttatggagtctgtaaagaaggagatc
tctaaaagtgtgttcagtatattttcccctgagcagctacggcactacaaagagaagatg
gaagagagagaggaagaaggactacttgtgtctcttattgacatgtggggtctggctata
gaatacctcatccaagggaagaaaaaaatgggaacactatctgaccagcagatggcacta
tcaaagggccagaaccctcttcccatctacacggctctcaacatgaagaatggcaagaca
ggatgtaccatagagactgaatggtgtgagttcaccccatatgaggtgggatttaccaag
tatggtgtcttcatacctgcacagaactttgggagtgaatattacctcggccacatggtc
aagaaactcccagaatctggaatttactctctattgggaatatggagcagtgttttctcc
ctgagtctgactcagctttggagtcgcatcactggagtgatcccatcctgggccagcaag
attgggaaaggagtgaaccagacagacacagatgacaaatcatcaacgtcagacacactt
caggccagccctaagactgacttggcaaaaaagctgagcaactttctgtcctgccgcccc
attatcagccaagtgttcaacttccttagaggcttccacctgcacaggaactacagtgag
aactgtgacttcacctcatggaaagacacacatccagatgccttcccaaactccctgaca
ccagcagatgccacacttggcctggttgactctgcttttgtcatcaagtcaggattccct
cctgtgttacgctgtaacagacgcgcggacgtcattctgtccctgaactacgcttgggac
ccggaccacttcaaggtcattaagcaaactcaggagtactgcgctgaacgcaagattccg
tttccaaagatcgattataagaagttggagtccgagccgattagggaagtttatgtgttt
gaggataaagagaatccagatgttcccatagtgatccactttcccttggtcaatgtctca
ttcaagcagttcaagtctcctggagtaaagagagagggtaaggaagagatgaaggatgga
gattttgatattgacttcaccagtttgttaagtccattctccactctcaaccttacatac
caacctgaggatttccagaagctgaccaacctcaccacctacaacattctgaacaacaca
gatgtcattttaaacacgctgaacaaagcactgaagagaaacatggagagaattcctctc
acaaaggcgtcaaaattctga

DBGET integrated database retrieval system