KEGG   Sinocyclocheilus grahami: 107553721Help
Entry
107553721         CDS       T04918                                 

Definition
(RefSeq) monoacylglycerol lipase ABHD12-like
  KO
K13704  abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
sgh  Sinocyclocheilus grahami
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:sgh01002]
    107553721
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sgh04147]
    107553721
Enzymes [BR:sgh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     107553721
Peptidases [BR:sgh01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   107553721
Exosome [BR:sgh04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   107553721
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Thioesterase Abhydrolase_3 Abhydrolase_2 Peptidase_S9 Peptidase_S15 Say1_Mug180 COesterase
Motif
Other DBs
NCBI-GeneID: 107553721
NCBI-ProteinID: XP_016091525
Position
Unknown
AA seq 368 aa AA seqDB search
TGTLLEGSSDLKQCHKKTAAASDPGGSGTAMGRRYRRGGLMWRLRKILIWVLGIYITIPV
IIKVCPSIQAKLVFLNFVRVPYFIDLKRPQDQGLNHTRNFYLQSEEGINIGVWHTVPSVM
WREAQAKDSEWYDKSFQSSHPVILYLHGNAGTRGGDHRVQLYKVLCSLGYHVVTFDYRGW
GDSEGSPSEKGMTSDAFFLYQWIKQRIGQKPLYIWGHSLGTGVATNLVRRLCDRGTPPDS
LILESPFTNIREEAKSHPFSMVYRYLPGFDWFFLDSITANDIRFASDENVNHISCPVLIL
HAEDDAVVPFQLGKKLYDLAAQSKSLNGHKVQFIPFPSSLGYRHKFIYKSPQLPNILSDF
LSAPHPHM
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
acgggtacactactggaaggcagctccgatctaaagcagtgccacaaaaagacagccgct
gcttctgatccaggaggttcggggacagcgatggggagacgctacaggaggggtggtcta
atgtggaggctgaggaagatactgatctgggtgctgggaatctacatcaccatccctgtt
atcatcaaagtctgtccatcaatacaagcaaaattagtatttttaaactttgtgcgagtg
ccatattttatagatctgaagagaccacaggatcagggcttgaatcacactcgcaatttc
tacctgcagtccgaggagggaatcaacattggagtgtggcacacagtgccttcagtgatg
tggagagaggctcaggcaaaagattctgaatggtatgacaaaagcttccagtccagtcat
cctgtcatcctgtatcttcatggaaacgctggaacaagaggaggggatcacagagttcag
ctgtacaaggttctttgttcattaggctaccatgtagtcacatttgattatagaggttgg
ggtgactctgagggaagcccttcagagaaaggcatgacatcagatgctttcttcctctac
cagtggataaagcagcggattggccagaagcccctgtacatatggggtcactcgctcggc
acaggagtggccactaacctagtgagacggctctgtgacaggggaacgcccccagactcc
ctaattttagagtcaccctttaccaatatcagagaggaagccaagagccatcccttctct
atggtttacagatatctaccaggctttgactggttcttcctggattctataactgcaaat
gacattcgttttgccagtgacgagaatgtcaaccacatatcctgtccggttctgatcttg
catgcagaagatgacgctgttgtacccttccagctgggaaagaagctgtatgatttggca
gctcagagcaagagtctgaacggtcataaggttcagttcatcccattccccagctctctg
ggctacagacacaagttcatctacaagagcccacagctaccaaatatactcagtgatttt
ctcagtgcgccgcatcctcacatgtag

DBGET integrated database retrieval system