KEGG   Sinocyclocheilus grahami: 107553769
Entry
107553769         CDS       T04918                                 

Definition
(RefSeq) ankyrin repeat domain-containing protein 53-like
  KO
K21441  ankyrin repeat domain-containing protein 53
Organism
sgh  Sinocyclocheilus grahami
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sgh03036]
    107553769
Chromosome and associated proteins [BR:sgh03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    107553769
SSDB
Motif
Pfam: Ank_5 Ank_4 Ank_2 Ank Ank_3 Peptidase_A2_2
Other DBs
NCBI-GeneID: 107553769
NCBI-ProteinID: XP_016091562
Position
Unknown
AA seq 199 aa
MCHPGPTAVDLGLSVLHIAALHGHLDCMELLLEDGGSADVNSSCPHGRRPVHMVLTAQSR
PNTHACLIYLLEHGAQINVYTDEGLTPLHLAAAEGLTDSTETLVRNGADIHAQDKRGHTP
LDLSRIWGHRLTARFLKDAMWWKDKQKRIMKSKQLHDLRQLQCCSVLDLPHLGRSLKPDA
SPWTEVAMHLAEELKPGHY
NT seq 600 nt   +upstreamnt  +downstreamnt
atgtgtcatcctggtcctacagcggttgatttgggtctcagtgtgcttcatatagcagct
ctacatggacacctggactgtatggagctgctgctggaggatggtggttctgcggatgtg
aatagcagttgtcctcatggacgcagacctgtacatatggtgctgactgctcagagccga
cccaacacacacgcctgcctcatttacctgctggaacatggagcccagatcaatgtctac
acagatgaaggactcactccactgcatctggccgctgctgaaggtctgacagacagtaca
gagacgctagtgagaaacggggcagacatacatgctcaagacaagaggggtcacacaccc
ctcgacctctctaggatctggggccacaggctcactgccaggtttctgaaagatgccatg
tggtggaaagacaaacagaagaggatcatgaaaagcaaacagctacatgatctcaggcag
ctccagtgttgcagtgtgctggatctgcctcacttgggtcgctccctaaaaccagatgcc
tcgccctggactgaggtggccatgcacctggctgaggagctgaagccaggacactattag

DBGET integrated database retrieval system