KEGG   Sinocyclocheilus grahami: 107553810Help
Entry
107553810         CDS       T04918                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1-like
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh00010  Glycolysis / Gluconeogenesis
sgh00562  Inositol phosphate metabolism
sgh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107553810
   00562 Inositol phosphate metabolism
    107553810
Enzymes [BR:sgh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     107553810
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     107553810
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 F_actin_cap_B
Motif
Other DBs
NCBI-GeneID: 107553810
NCBI-ProteinID: XP_016091606
Position
Unknown
AA seq 300 aa AA seqDB search
MVKQVVTTICFFLFHCIISYWAFMSSCSIHSSPKISIPAIARYFGTKGRYEDVNTYLIDD
LLATNNSLVTLPSSKCSEIHLTAIIRHGTRYPTTKNIQKMREFYDLVVRDATGNLNCLSE
IKSQWKMWYTDDMDGRLVDKGRADHRHLAQRLIKWFPSLLTEDNVRNGRVKLITSSKHRC
VNSTIAFREGLMKGLSIKVELEPAVNDALMRYFDQCERFVKEVENNKSALEEVKRFNEGP
EMKRVMEKMADRLDVPYASITDDSVEAAFFLCAYEFTIHDLNSPWCQLFDEVDAQLNKGI
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atggtcaaacaagtggtaacaaccatatgcttttttctttttcattgcattataagttac
tgggcgtttatgtcctcttgtagcatccactcatccccaaaaatcagcattccagcgatc
gccaggtattttggtaccaaaggtcgctatgaagatgtcaacacgtacttaatcgacgat
cttttggccacaaacaactcccttgtgacgctgccttcctcgaaatgcagcgaaattcat
ctgacagctataatccggcatgggacgaggtacccgaccactaaaaacattcagaagatg
cgcgaattttatgatctcgtcgtgcgtgatgcgaccggcaacttaaactgtttgtcagag
ataaagtcgcagtggaagatgtggtacacggatgatatggacgggcgactggtggacaag
ggccgtgcggatcacaggcacctagcgcagagactcatcaaatggttcccttctttgctg
accgaggacaatgtgcgtaacggacgcgtgaaactgatcaccagctccaagcacaggtgt
gtgaacagtaccatcgctttcagagagggactaatgaaaggactcagcataaaagttgag
ttggaacctgctgttaatgacgctttaatgcgttactttgaccagtgcgaacggtttgtg
aaagaagtggagaacaacaagagcgccttggaggaagtgaaacgatttaatgaaggccct
gagatgaaaagagtaatggagaaaatggctgacaggctggatgtcccttacgccagcatc
accgatgattcagtggaagcagctttctttctgtgtgcatatgagtttactatccatgat
ctgaactcaccctggtgccagttgtttgacgaggtagatgcacagcttaataaggggata
taa

DBGET integrated database retrieval system