KEGG   Sinocyclocheilus grahami: 107557422Help
Entry
107557422         CDS       T04918                                 

Definition
(RefSeq) equilibrative nucleoside transporter 1-like
  KO
K15014  solute carrier family 29 (equilibrative nucleoside transporter), member 1/2/3
Organism
sgh  Sinocyclocheilus grahami
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sgh02000]
    107557422
Transporters [BR:sgh02000]
 Solute Carrier Family (SLC)
  SLC29: Facilitative nucleoside transporter
   107557422
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nucleoside_tran DUF2208
Motif
Other DBs
NCBI-GeneID: 107557422
NCBI-ProteinID: XP_016096323
Position
Unknown
AA seq 435 aa AA seqDB search
MDPQVPKDKYNGVWLIFFTLGLGTLLPWNFFMTATMYFSSRLADPLSEANLSANATEEDS
RSVLQAKFNNVMTLCAMVPLLGFTCLNSVLHQRIAQKIRIAGSLTAILLVFLLTAILVKV
DLEPLPFFIITMIKIICINSFGAVLQGSLFGMAGLLPASYTTPIMSGQGLAGTFAALSMI
CAIASGSAIHDSAFGYFITACVVISLAIAAYALLPKLEFFQYYQESQQSKPAEDEENKMD
LLKKDERQKSAGDDNKQTPSILVIFKKIWVMAFSVCFAFTITIGTFPAITVDVKSTIADG
GQWELYFIPVSCFLLFNVFDWLGRSLTAVCMWPGKDSKLLPGLLVARVIFVPLFMLCNVK
PRHNLPVYFSHDGWFLGFMILFAFSNGYLASLCMCFGPKKVDASEAETAGTIMAFFLSLG
LALGASLSFLFRALI
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atggaccctcaggtgcccaaagacaaatataatggcgtgtggttgattttcttcacgctg
gggttgggaacgctgctgccgtggaatttcttcatgacagctactatgtatttcagcagt
cgtcttgcagaccctttaagtgaagcgaatctctcagccaacgcgactgaagaagactcg
cggagcgtcttacaggccaagtttaataatgtgatgacgctgtgtgcgatggttcctctg
ctgggcttcacctgcctcaactcagtgcttcaccagagaattgctcagaagatccggatc
gcagggagtctgacggccattctgctggtgtttctgctcactgccatcctggtgaaagta
gatctggagccactgccgttcttcatcatcaccatgattaaaatcatctgcattaactcg
ttcggagcggttcttcagggaagtctgtttgggatggccggactcctgccagcgtcctac
accacacccatcatgagcggacagggactcgcaggaaccttcgctgctttatccatgatc
tgcgccatcgccagtggttctgctatacacgacagtgcttttggatacttcatcacagcg
tgcgtcgttatttccctcgccatcgcagcatacgctctccttcctaaactggagtttttt
cagtactatcaggagagtcagcagagcaaaccagctgaggatgaagagaacaagatggat
cttctgaagaaagatgagcggcagaagagcgctggagacgacaacaaacaaacaccatcc
atactggtcatctttaagaagatctgggttatggcgttctctgtgtgtttcgccttcacc
atcaccatcggcacgtttcccgccatcactgtggatgttaaatctactattgctgatggc
ggacagtgggagctgtatttcatcccagtgtcttgtttcctgttattcaacgtgtttgat
tggctgggtcgcagtctgaccgctgtctgtatgtggcctggtaaagacagtaagctgctg
ccgggtctgttagtggcccgtgtgatttttgtccctctcttcatgctctgtaacgtcaag
cctcgccacaatctgcccgtctacttctcacacgacggctggttcctcggcttcatgatc
ctctttgctttttctaacggatatctggcgagtctgtgcatgtgcttcggacccaagaag
gtggatgcgagcgaggcggagacggctggaacgatcatggccttcttcctgtctctcggt
ctggctctcggagcgtctctgtcgtttctgtttcgagcgctcatctga

DBGET integrated database retrieval system