KEGG   Sinocyclocheilus grahami: 107557767Help
Entry
107557767         CDS       T04918                                 

Gene name
b4galt4
Definition
(RefSeq) beta-1,4-galactosyltransferase 4
  KO
K07969  beta-1,4-galactosyltransferase 4 [EC:2.4.1.90 2.4.1.275 2.4.1.-]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh00533  Glycosaminoglycan biosynthesis - keratan sulfate
sgh00601  Glycosphingolipid biosynthesis - lacto and neolacto series
sgh01100  Metabolic pathways
Module
sgh_M00071  Glycosphingolipid biosynthesis, neolacto-series, LacCer => nLc4Cer
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00533 Glycosaminoglycan biosynthesis - keratan sulfate
    107557767 (b4galt4)
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    107557767 (b4galt4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:sgh01003]
    107557767 (b4galt4)
Enzymes [BR:sgh01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.90  N-acetyllactosamine synthase
     107557767 (b4galt4)
    2.4.1.275  neolactotriaosylceramide beta-1,4-galactosyltransferase
     107557767 (b4galt4)
    2.4.1.-  
     107557767 (b4galt4)
Glycosyltransferases [BR:sgh01003]
 Glycan extension
  Type 2 chain/Poly-N-acetyllactosamine
   107557767 (b4galt4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_7N Glyco_transf_7C
Motif
Other DBs
NCBI-GeneID: 107557767
NCBI-ProteinID: XP_016096777
Position
Unknown
AA seq 350 aa AA seqDB search
MGLFPSISKIMRKGKGLFLLLLCLCVVAWIATFSNDDTVKSVQEGSNPLDDRSVEGFAQL
ELESEMMQSLEEQQSVRKSCPEHSPLLRGAIKLSFDPSLTIEQVESDNGEVVEGQYNPSD
CEARQSVAILIPHRNREKHLLYLLHHLHPFLQRQQLHYAIYIIHQAGDATFNRAKLLNVG
YLEALKDQSWDCFIFHDADLVPENDHNLYMCEDQPKHLVVGRNSTGYKLRYKGYFGGVSA
MTKEQFHKVNGFPNSYWGWGGEDDDLRIRVTLQKMSIIRPSLEVARYTMVFHNRDSGNQI
NEERMHLLRRTHQAWKTDGLNSCSYKILSVHRAPLFINITTDIGQPEIAL
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgggcctctttccatccatatccaagatcatgaggaaggggaagggtctgtttcttctg
ctgttgtgtctgtgcgttgtagcatggatagcaacattctcaaatgatgacacagttaag
tctgtccaggagggatcgaatcctcttgacgacaggagtgtcgagggctttgctcagctg
gagctggaatcagagatgatgcagagcttagaggagcagcagtctgtcagaaagagctgt
ccagagcattcacccctgctccgaggcgctatcaagctgtcatttgatccctcgctaacg
atagagcaggtagagagtgacaacggggaggtggtggagggtcagtataacccctctgac
tgtgaggccagacagagcgtggccatccttatccctcacagaaacagagagaagcacctg
ctctacctcctccaccacctccacccgttcttacagaggcagcagcttcactacgccatc
tacatcattcaccaggctggagatgctacatttaacagggcaaagttattaaatgtgggc
tacctcgaggctctgaaagaccagagctgggactgtttcatcttccatgatgctgatcta
gttcctgagaacgatcataatttatacatgtgtgaggatcagcctaagcacttagtagtg
gggaggaattccactgggtacaaactccgatacaagggttactttgggggagtttcggcc
atgacgaaggagcagttccacaaggtcaatggcttcccaaactcctactggggctggggt
ggagaggacgatgacctgagaataagggtgacgctgcagaaaatgtcaataatccgtcca
tccctggaagtggcgcgctacaccatggtctttcacaatcgggacagcggcaatcaaatc
aatgaagaaaggatgcatctgttacgccgcactcatcaagcgtggaaaactgatggcttg
aactcctgttcctacaagattctgtctgtccacagagcaccactcttcatcaacatcacc
acggacattggccagccggagattgctctttga

DBGET integrated database retrieval system