KEGG   Sinocyclocheilus grahami: 107558798Help
Entry
107558798         CDS       T04918                                 

Definition
(RefSeq) gamma-glutamyltransferase 7-like
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh00430  Taurine and hypotaurine metabolism
sgh00480  Glutathione metabolism
sgh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    107558798
   00480 Glutathione metabolism
    107558798
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sgh01002]
    107558798
Enzymes [BR:sgh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     107558798
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     107558798
Peptidases and inhibitors [BR:sgh01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   107558798
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-GeneID: 107558798
NCBI-ProteinID: XP_016097973
Position
Unknown
AA seq 667 aa AA seqDB search
MYSPAADTGVTVVEKDAALSSAYSPVDYMSITSFPRLPEDEVSADNILKSRKDNDNFLSE
QDTDPDLFLKTARLQQLPSSASDLASQDISPLRETSRDPLAQDCACTRDGLTVIITACLT
FATGVTVALIMQIYFGDPQVYNQGAVVTDVARCTSLGFDVLGKQGSSVDAAIAASLCLGI
IHPHTSGIGGGGVMLVHDIRRNESRVIDFRETAPSGIHENLMLHVNQRSGLLVAVPGMIS
GLHQAHQLYGRMLWKDVITMAADVARTGFNVTHELADALSEVKEQNVSDAFRDLFLPNGQ
APLAGLFTKRLDLAAVLDRIAANGVSEFYSGNLTQEITSVVQAKEGVLTEDDFKNYTTVI
QKPLQSLYQGYRVLVPPPPHAGAALLSALNILEGFNITNQVSRSSVYHWIAESLKIALSQ
ASGLGDSVFNSSVSELVTQMLSKDKAAVFRQMISDSQAYAAEHYTPSYELQEGAVASQLM
IMGTDDLIVSVMSSLNRPFGSRIVTPSGILLNSQMLDFSWPNKPHSSAAVNLHNSIEPGK
RPASFLTPIVVRPSMGQCGSYVALGSSNGERALSGITQVLINVLSSRNNMSDSVSYGRLH
PLIQNNTLLVDSKFLEEDVKSLMQKGHDVRKVDIISLVEGTRRTNDLIIGVKDPRSTDAS
ALSMSMP
NT seq 2004 nt NT seq  +upstreamnt  +downstreamnt
atgtactctccggcagccgatacgggagtgacggtggttgagaaggatgcggctctgagc
agcgcgtactcacctgtggactacatgagcatcaccagcttccctagactaccagaagat
gaagtttcagccgacaacatcctcaaatcacgcaaagacaatgataacttcctcagcgag
caggacacagaccccgatctgttcctgaagacggcccgactgcagcagctgccctcctct
gcctcagacttggccagtcaggatatctctcctctgagagagaccagcagagacccgctg
gcacaggactgcgcctgcacacgtgacgggctgaccgtcatcatcacggcctgcctgacc
ttcgccacgggagtcaccgtggccctcatcatgcagatctactttggagacccacaggtg
tataatcaaggcgcggtggtgacagatgtggcccgctgcacgtctctgggctttgacgtt
ttgggcaaacaggggtccagtgttgatgctgctatagctgcttccctctgtctgggcatc
atccatccccacacctcgggcatcggcggtggtggcgtgatgctggtccatgacatccgc
aggaatgagagccgggtcattgacttccgcgagacggcaccctctggcattcacgagaac
ttgatgttacatgttaatcaaaggtcaggtctgttagtggctgttcccggcatgatcagt
ggactacaccaagctcatcagctctatggaagaatgctgtggaaggatgtcatcacgatg
gctgccgatgtggcgaggactggattcaatgtgacgcatgagctggctgatgcgctgtct
gaagtgaaggagcagaatgtgtcggatgcattcagagatctgttcctgccgaacggtcag
gctccactcgcgggactcttcactaaacgcctggatttagctgccgttctggacaggatt
gcagccaatggagtctccgagttctacagtgggaatctgactcaggaaattacatcagtg
gttcaagctaaagaaggtgtgctgacagaggatgacttcaaaaactacaccactgtcata
cagaagccactgcaaagtctttaccagggctaccgggtgttagttcctcctccgccccac
gcgggagccgccctgctgtccgctctcaacatcctggagggatttaacatcacaaaccag
gtgtccaggagcagcgtttaccactggatagctgagtctctgaagattgctttgtctcaa
gccagtggactgggagactccgtgttcaattcatcggtttctgagctggtgacgcagatg
ctcagtaaagacaaggctgctgtgttccggcagatgatcagtgattcgcaggcgtacgcg
gctgagcactacacgccgtcatacgagctgcaggagggcgctgtggccagccagctcatg
atcatgggcactgatgacttgatcgtgtctgttatgagctctctaaaccgaccgtttgga
agtcgcatcgtgacgccctctgggatcctcctaaacagccagatgctggacttctcttgg
cccaacaaaccccacagctctgcggctgtcaatctgcataacagcattgagccgggcaag
aggccggcctcgttcctgacgccgatcgtggtgaggccgtctatggggcagtgtggcagc
tacgtggcgctgggctcctctaacggcgagcgggcgctgagcggcatcacgcaggttttg
atcaatgttttgtcatcacgtaataacatgagcgacagcgtgtcctacggcagactgcat
cctctcatccagaacaacaccctgctggtggactctaagtttcttgaggaggatgtgaag
tctctgatgcagaagggtcatgatgtgcgtaaggtggacatcatctcactggtcgaaggg
acccggaggaccaatgacctgatcatcggtgtgaaggacccacgcagcactgacgcctca
gcactgtccatgtccatgccctag

DBGET integrated database retrieval system