KEGG   Sinocyclocheilus grahami: 107559105Help
Entry
107559105         CDS       T04918                                 

Definition
(RefSeq) dual specificity protein phosphatase 10-like
  KO
K20216  dual specificity phosphatase 10 [EC:3.1.3.16 3.1.3.48]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107559105
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sgh01009]
    107559105
Enzymes [BR:sgh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     107559105
    3.1.3.48  protein-tyrosine-phosphatase
     107559105
Protein phosphatases and associated proteins [BR:sgh01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   MAPK phosphatases
    107559105
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DSPc Rhodanese PTPlike_phytase Y_phosphatase Init_tRNA_PT RL
Motif
Other DBs
NCBI-GeneID: 107559105
NCBI-ProteinID: XP_016098315
Position
Unknown
AA seq 464 aa AA seqDB search
MPPSPLDDRIVVALPRPIRPQELRLRLDTSYLEATVGTVGQSTVISSTTVVKIQATKLSY
MPSSSGSTRSLTCGCSSASCCTVTTYEKDGQVSASSPNLNSGVGYGVPTVGHGEAYSAPS
LTSSLTRGGMRVIHPNELAKKLTHCPLGHPVGPVPVIIDCRPFMEFNKSHIRGAVHINCS
DKISRRRLQQGKITVLDLISCRQSKDSFKGIFSKELVVYDESTVDPGRLTPSQPLQVVLE
SLRREGKDPIVLKGGLAGFQQSHGDLCEHSLHLEEGQDGRTTVGLSGALPHSLPSTPDIE
NAELTAILPFLFLGNERDAQDLELMQRMDIGFILNVTTHLPLYHYELGLFKYKRLPASDS
NKQNLRQYFEEAFEFTEEAQQAGRGLLIHCQAGVSRSATIVIAYLMKHTWMTMTDAYKFV
KSRRPIISPNLNFMGQLLEFEEDLNNGITPRILTPKLTGLETVV
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgcctccttctcctctagacgacagaattgtggtggcgctgccaaggcctatacgacct
caggaactccgactccgcctggacaccagctacctggaagccaccgtgggcaccgtcggt
cagtcgacggtcatcagcagcaccaccgtggtgaagatccaggcgaccaagctttcgtat
atgccctcgtccagcggctccacgcgctcgctgacgtgtggatgcagcagtgccagctgt
tgcacggtgaccacctacgagaaggacggccaggtcagtgccagcagccccaacttgaac
tccggagtgggctatggcgtcccaacggtgggccacggcgaggcctacagcgcgcccagt
ctcacctccagcctgaccaggggcggcatgcgggtcatccaccccaacgagttggccaaa
aagctgacgcattgccccctgggccacccggtcgggccggtgcccgtcatcatcgactgt
cggcccttcatggagtttaacaagagccacatccggggcgccgtgcacatcaactgctcg
gacaagatcagtcgccgacggctccagcagggcaagatcaccgtcctggacctcatctcc
tgccggcagagcaaggactccttcaaggggattttttccaaagagctggtggtgtacgac
gaaagcacggtggacccgggccgcttgacgccgtctcagcctctgcaagtggttctggag
tcgctgcggagggaaggaaaggaccccatcgttctgaaaggaggcctcgccggtttccaa
cagagccacggtgatctgtgcgagcactctcttcacctggaggaaggacaggacggcagg
accacggtgggcctgtcgggggcgctacctcattccctgccctccacaccggacatcgag
aacgcagagctgacggccatcctccccttcttgttcctgggcaacgaacgggacgctcag
gacctggagctcatgcagcggatggacatcggcttcatcctgaacgtcaccacgcacctg
ccgctctaccactacgagctcggcctgttcaagtacaagcgcttacccgccagcgacagc
aacaagcagaacctgcggcagtacttcgaggaggccttcgagttcacagaggaggcgcag
caggccggccgggggctcctcattcactgccaggccggcgtgtctcgttccgccaccatc
gtcatcgcctacctgatgaaacacacctggatgaccatgacagacgcatacaagttcgtc
aagtcccggcggcccatcatctcgcccaacctcaacttcatgggccagcttctagagttc
gaggaagacctgaacaacggcatcactccacgcatactcacgcccaaactcaccggcctc
gagaccgtcgtatag

DBGET integrated database retrieval system