KEGG   Sinocyclocheilus grahami: 107559410
Entry
107559410         CDS       T04918                                 

Definition
(RefSeq) deoxycytidine kinase-like
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh00230  Purine metabolism
sgh00240  Pyrimidine metabolism
sgh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107559410
   00240 Pyrimidine metabolism
    107559410
Enzymes [BR:sgh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     107559410
SSDB
Motif
Pfam: dNK AAA_18 AAA_33 Thymidylate_kin AAA_28 AAA_17
Other DBs
NCBI-GeneID: 107559410
NCBI-ProteinID: XP_016098709
UniProt: A0A672Q4B8
Position
Unknown
AA seq 264 aa
MATPPKRFCSSLDVDLSFEKRALKISIEGNIAAGKSTFVHLLERASEEWEVIPEPIGKWC
NVQSTENEYEELSTSQKSGGNLLQMLYDKPSRWSYTFQTYACLSRVRAQLQPPSAKLQQA
EQPVQFFERSVYSDRYVFASNLFESGDLNETEWAIYQDWHSWLLTQFESQIELDAMIYLR
ADPERCMQRLQFRGREEEQGIPLDYLEKLHYKHECWLYNRTTKLDFKYLKDLPILVLDVN
EDFKNDRIKQESIIDKVKEFLNTL
NT seq 795 nt   +upstreamnt  +downstreamnt
atggctactcctccgaagagattttgttcaagcctcgacgttgacctcagtttcgaaaaa
agggcattgaagatctcaatagagggaaacattgcggcagggaagtcaacttttgtgcac
ttgttggagcgggcgtcagaggagtgggaagtcataccagagcccattgggaagtggtgc
aatgtacaaagcacagagaacgagtatgaggagctcagcacatcccagaagagtggaggc
aacctgctgcagatgttgtatgacaagcccagtcgctggtcttacactttccagacctac
gcctgcttgagtcgcgtccgtgcacagcttcagcctccttctgccaaacttcagcaggca
gagcagccagtccagttctttgagcgctctgtctacagtgatcgatatgtctttgcctct
aacctctttgagtctggagatctgaatgagactgagtgggccatctatcaagactggcat
tcatggctcctcactcagtttgagtcccagattgagcttgatgccatgatctatcttcgc
gctgatcccgagaggtgtatgcagcgtcttcagttcagaggacgagaggaggaacaaggg
attcccttggactacctggagaagcttcattataagcatgagtgttggctgtacaaccga
accacaaagttggattttaagtatcttaaagaccttccaatactggtcctggatgttaat
gaggattttaaaaatgaccgaattaagcaagaaagtattattgataaggtgaaggagttt
ttgaacaccctgtag

DBGET integrated database retrieval system