KEGG   Sinocyclocheilus grahami: 107560602Help
Entry
107560602         CDS       T04918                                 

Gene name
pin1
Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
  KO
K09578  peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 [EC:5.2.1.8]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04622  RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    107560602 (pin1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:sgh03021]
    107560602 (pin1)
   03110 Chaperones and folding catalysts [BR:sgh03110]
    107560602 (pin1)
Enzymes [BR:sgh01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     107560602 (pin1)
Transcription machinery [BR:sgh03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     107560602 (pin1)
Chaperones and folding catalysts [BR:sgh03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Parvulin
    107560602 (pin1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rotamase Rotamase_3 WW Rotamase_2 X8 Nup88
Motif
Other DBs
NCBI-GeneID: 107560602
NCBI-ProteinID: XP_016100312
Position
Unknown
AA seq 159 aa AA seqDB search
MSDDQQLLSGWEKRMSRSSGRVYYFNHITNASQWERPSGAGPDGVSEVEKVRCSHLLVKH
NQSRRPSSWREENITRSKEEALQLIQKYIEQIKSGQEDFESLASQFSDCSSARNGGDLGL
FGRGQMQKPFEDVSFALEIGDMSGPVFTDSGVHIILRTG
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacgaccagcagctgctgtccgggtgggagaagcgcatgagccggagctcaggt
cgggtttattacttcaatcacatcacgaatgcgagtcagtgggagcggccgagcggagcg
gggcccgacggcgtcagcgaggtggagaaagtgcgctgctctcacctgctggtcaaacac
aaccagtcgcgccggccgtcctcctggagagaggagaacatcacacgcagcaaagaggag
gcgctgcagctcatccaaaagtacatcgaacagatcaagtctggccaggaggactttgag
agtttggcgtctcagttcagtgactgcagctcagcgaggaacggaggagacctgggcttg
ttcggcagaggtcaaatgcagaagccgtttgaagacgtctcgttcgcgctggagatcgga
gacatgagcggccccgtgttcaccgactcaggagttcacatcatcctgagaaccggataa

DBGET integrated database retrieval system