KEGG   Sinocyclocheilus grahami: 107560889Help
Entry
107560889         CDS       T04918                                 

Definition
(RefSeq) monoacylglycerol lipase ABHD6-like
  KO
K13700  abhydrolase domain-containing protein 6 [EC:3.1.1.23]
Organism
sgh  Sinocyclocheilus grahami
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:sgh01002]
    107560889
Enzymes [BR:sgh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     107560889
Peptidases [BR:sgh01002]
 Serine Peptidases
  Family S33
   107560889
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_6 Abhydrolase_1 Hydrolase_4 DUF1057 LIDHydrolase DLH Ndr Thioesterase DUF2048 Gmx_para_CXXCG Esterase
Motif
Other DBs
NCBI-GeneID: 107560889
NCBI-ProteinID: XP_016100653
Position
Unknown
AA seq 339 aa AA seqDB search
MDRDMVNMFAIAAGTLAIPLLLFMASFMLWPSSLIKVYYWYWRRTLGLRVRHADCGGYRF
CYSYRGKPGLRPSVLMLHDFSAHKDTWLPMVKYLPKHLHLLCVDMPGHEGTTRTNTDDYS
IQGQVKRIRQFVEAIRLNRKPFHLVGTSMGGTVAGVYAAYHPSDLCGLTIICPVGLKNQM
ESQFDSQMHEVEHSQYTLNIPLIPSTPEEMEEMLKLCSHVRFRVPQQILQGLVDVRIPHN
DFYHEVFMEIMSENSKYALHEHIQQITTPLQVIWGKQDQVVDVSGAALLTEALPGCRVDL
LENCGHSVVMERPRQTAKLILDFINSQQSTESTSTKKKS
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atggatcgggatatggtcaatatgtttgccattgctgcagggactcttgctatccctctc
ctccttttcatggcctcttttatgctgtggccatcatcactcatcaaagtctattactgg
tactggaggagaactctgggtctgcgggtacgtcatgcagactgcgggggttatcgcttc
tgttactcatacagggggaaaccaggcctcaggccttctgtactcatgctgcatgacttc
tctgctcacaaggacacatggcttcctatggtgaagtaccttcccaaacatctgcactta
ctgtgtgttgacatgccggggcatgagggtacaacacgtaccaacacagacgactattca
atccagggccaggtcaagagaatacggcagtttgtagaggcaattcggctaaacagaaag
ccattccatctggtgggcacttcaatgggtgggactgtggccggagtgtatgcagcctat
catccctcagatctctgcggtttgaccatcatctgcccagttggtctgaagaaccaaatg
gagagccagtttgacagtcagatgcatgaagtggagcacagccagtacacgctgaatatt
cctcttattccgtccaccccggaggagatggaggagatgctgaagctctgttctcatgtg
cgcttcagagtgcctcaacagattctacaaggcctcgtggatgtacggataccacacaat
gacttttatcatgaagttttcatggaaattatgagtgaaaattcaaaatatgccttgcat
gagcatatacagcaaataactacccctttacaagtcatctggggcaaacaggaccaggtg
gtggatgtgtctggggcagcgttgctcacggaggctcttccaggctgtcgtgttgatctg
ctggagaactgcggtcattctgttgtgatggagcgaccgcgacaaacagccaaactcatt
ttagatttcatcaattctcagcagagcacagagagcaccagcaccaaaaagaaatcctga

DBGET integrated database retrieval system