KEGG   Sinocyclocheilus grahami: 107561340Help
Entry
107561340         CDS       T04918                                 

Definition
(RefSeq) voltage-dependent T-type calcium channel subunit alpha-1I-like
  KO
K04856  voltage-dependent calcium channel T type alpha-1I
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04010  MAPK signaling pathway
sgh04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107561340
   04020 Calcium signaling pathway
    107561340
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:sgh04040]
    107561340
Ion channels [BR:sgh04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   107561340
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans PKD_channel
Motif
Other DBs
NCBI-GeneID: 107561340
NCBI-ProteinID: XP_016101252
Position
Unknown
AA seq 2070 aa AA seqDB search
MKGKHSIMVILLNCVTLGMYQPCENIDCTSERCQILQAFDAFIYIFFALEMVVKMVALGI
FGHRCYLGDTWNRLDFFIVMAGIVEYSLDLQNINFSAIRTVRVLRPLKAINRVPSMRILV
NLLLDTLPMLGNVLLLCFFVFFIFGIIGVQLWAGLLRNRCYPEENFTLTSGITLPTPYYQ
PEEDDERPFICSLAQDNGIMSCSDVPARREGGRECCLDKEDALHRQTLGLSAEPLVNGSA
STVGLCVNWNQYYTRCHTGHTNPHKGAINFDNIGYAWIVIFQVITLEGWVEIMYYVMDAH
SFYNFIYFIFLIIIGSFFMINLCLVVIATQFSETKQREHQLMQEQRARYLSSSTLASLAE
PGDCYEELFQLVCHILRKARRRSAALYYMLRGKAPPPGGGRWRGKGGAGSTGGGANVNGS
ERHHCHSTQIPHCIHDTKLDQSSQSLENAISLSVTPKTEECLQCAAAPSLKEGLRLMGHS
ANGEEEEVALEENDRDENRLDEKGDNDSEDMPKRKRTCLGKCKDIWDKMSARLWGIVESK
YFNRGIMIAILINTISMGIEHHNQAIVVCEIIGQSDGGLSVLRTFRLLRVIKLVRFMPAL
RRQLVVLMKTMDNVATFCMLLMLFIFIFSILGMHIFGCKFSLKTEAGDTVPDRKNFDSLL
WAIVTVFQILTQEDWNMVLYNGMASTSPLAALYFVALMTFGNYVLFNLLVAILVEGFQAE
GDANRSCSDDDRSSCNLEETEKKDSLQLSDPKISTLTPNGHLDLAPAPNARGLYPSERLS
FALSSRKSSMSSLSRASLEQTTLCPGRASMYHNWGQPARPGIWSRRSSWNSLSRSSRCLG
MGGGGSLRVCSPHSRPVEQESLLSPPPPPLHPPLLSRHFIPRRERRALSLELPELLQVPG
PALPPLEARQCKKSFSGGLGSVGEHQDCNGKTPSVQPQIINEVYPQVNARKDREDLDDEL
DYSLCFRMQKMIEVYRPDWCETREDWSVFLFSPQNKFRMLCQSIIAHKLFDYVVLAFIFS
NCITVALERPKILQGSLERLFLTVSNYIFTAIFVGEMTLKVVSMGLYIGEQAYLRSSWNV
LDGFLVFVSLIDIVVSMAGGAKILGVLRVLRLLRTLRPLRVISRAPGLKLVVETLITSLK
PIGNIVLICCAFFIIFGILGVQLFKGKFYYCLGLDVKNITNKSDCLLANYKWVHHKYNFD
NLGQALMSLFVLASKDGWVNIMYHGLDAVAVDQQPITNNNPWMLLYFISFLLIVSFFVLN
MFVGVVVENFHKCRQHQEVEEAKRREEKRLRRMEKKRRKAQKLPYYASYSHVRLMIHTLC
TSHYLDIFITFIICVNVVTMSLEHYSQPRSLEITLKYCNYFFTSTFVLEAVLKLIAFGFR
RFFKDRWNQLDLAIVLLSVMGIILEEIEISASLPINPTIIRIMRVLRIARVLKLLKMATG
MRALLDTVVQALPQVGNLGLLFMLLFFIYAALGVELFGELVCNEDYPCEGMSRHATFENF
GMAFLTLFQVSTGDNWNGIMKDTLRECPPGEYTCNPSLQFISPMYFVSFVLTAQFVLINV
VVAVLMKHLDDSNKEAQEEAEMDAEIELELAQGTLCCIGGGGSGAERSSGGHQGAGPCST
LPPHSPNTHPGAHEPNSTRKLYSPAQENLWLDSVSLLIKDSFEGEMLMIDNLSGSVFHHY
SSPPICKDCRTHPQEQIHMAELEQASLRSEQLSDKSSSPALPDDLSLDEQSVYQMSAKEG
KERGCDECLNTEEPGGRGHSRLRRPSRVHSSGTEEGVAVNGASSQSPHHNTPARHSIGGV
PSSNQEYPGVSGASSRSTTPIHLIAEFFHPAAAALPAPPRGRPGHKPRGLRLTSPASWAS
LRSPGANTRLLTTQYSSHSDSSLATGSSESSLPTTMEEGLSFTTQPLLDTLLDDRSSLST
KTLRPSPPAAQNLQTMRGHQRSKSSCERDINAGRTRQDSDEDVGMVRCGSNQTCDSQQLS
ETPSSLSLTSLLLPSSLAPPFVKKCNSTGSLDQGILTTQENVFIKEPQGKITSPWKERKE
GRRESQSEAAQGKDGESTSQITIVGSRRNR
NT seq 6213 nt NT seq  +upstreamnt  +downstreamnt
atgaaggggaaacatagtatcatggtgatcctgctgaactgcgtcactctggggatgtac
cagccctgcgagaacatcgactgcacctcagagcgctgtcagattctacaggcattcgat
gcatttatctatattttctttgcactggagatggtggtgaagatggtggctctggggatc
tttggccatcgctgttatcttggcgatacttggaacagactggactttttcattgtcatg
gcagggattgttgaatactcccttgatctccagaacatcaatttctccgccatcagaaca
gtgcgtgtactcagacctctcaaagccatcaacagagtacccagtatgcgtatcctggtg
aacctactgctggacactctgcccatgctgggaaatgtgcttctgctctgtttctttgtc
ttcttcatttttggcataattggcgtgcagctatgggctggactattaagaaatcgctgt
tacccagaggagaacttcaccctcacatctggcatcaccctccccaccccatattatcag
cctgaggaggatgacgagcggcccttcatctgctctctggctcaggataacggcatcatg
tcctgcagcgacgtccctgctcggagagaaggtggacgggagtgctgtctagataaagag
gatgcactgcaccgtcagaccctgggcctgagcgcggagccactggtcaatggcagtgcc
tccaccgtggggctctgtgtgaactggaaccagtactacacccgctgtcacacaggacac
accaacccacacaaaggagcgatcaactttgacaacataggttacgcatggatcgtcata
tttcaggtgatcacgctggagggttgggtggagatcatgtactacgtcatggatgctcat
tccttctacaacttcatctacttcatattcctcattatcattggatctttcttcatgatt
aatctgtgcctggtggtcattgccactcagttttcggagaccaaacagcgagagcaccag
ctgatgcaagagcaacgtgctcgctacctgtcctccagcacgctggcttcgctcgctgag
cccggagactgttacgaggagctcttccagctggtctgccacatcctgcgcaaggcccgc
cgccgctcagccgccctttactacatgctccgtggcaaagcccctccccctgggggaggg
aggtggcgtggcaaaggaggggcaggatcgacagggggaggggctaatgtgaatggcagc
gaaagacaccactgccattctactcagatccctcattgtattcatgataccaagttggac
cagagctcccaatctctggagaacgccatctccctctccgtcaccccaaaaacagaggag
tgtctacagtgtgctgcagccccgtcactcaaggaggggctgagactgatggggcactcg
gccaatggggaggaagaggaggttgcgctggaggagaacgacagagatgagaaccgattg
gatgagaagggggacaatgactctgaggacatgccgaagaggaaacgcacctgtttaggg
aaatgtaaagatatttgggataaaatgagcgcgaggctttggggtatagttgaaagcaag
tacttcaacagagggattatgatcgccatcctcatcaatacgatcagcatgggcattgag
caccataaccaggctattgttgtatgtgagatcattgggcagtctgacgggggtctgtcc
gtcctgaggacgttcagactgttgagggtcataaagctggtgcggttcatgccagctctg
cgcagacaactggtggtcctgatgaagaccatggacaatgtggccaccttctgtatgtta
ctaatgctctttatcttcatattcagtattctgggaatgcacatatttggctgcaagttc
agcctgaagacagaggctggggacacagtacctgacaggaaaaactttgactccctgctt
tgggccattgtcacagtgtttcagattctaactcaagaggactggaacatggttttgtat
aacggcatggcctctacctcccccctggcggccctgtattttgtcgcgctcatgactttt
gggaactacgttctgttcaatctgcttgtggctatcttagtcgaaggatttcaggctgag
ggtgatgctaaccgttcctgctctgatgacgacagatcctcttgtaacttagaagaaact
gagaaaaaggactcactccagctgtccgatcccaagatttccactttgacccctaatggg
catctggatttggcacctgcacccaatgccaggggcctgtacccatctgaaaggctgagc
tttgccctgagttcccgtaagagcagcatgagctctttgagcagggctagcctggagcag
acgacgctgtgtccagggcgagcctctatgtaccacaactggggacagcctgcacgacca
ggaatatggagtcgcaggtcaagctggaacagcttaagtcgatcttctagatgcctggga
atggggggcggaggcagtttaagggtctgtagccctcactctcgtcctgttgagcaggag
tccctgctgtctcctccgccccctcctctgcacccgcctctgctctctagacacttcatc
ccgcgcagagaacggcgggctctctctttggagcttcctgagctgctgcaggtgcctgga
ccggccctgcctcctctggaggcacggcaatgcaagaagagcttctctgggggtctggga
agtgttggagagcaccaggactgtaatgggaagacaccatcagtccaaccacaaatcatc
aatgaagtctaccctcaggtcaatgcacgcaaggacagggaggatctggacgatgagctg
gactatagtctatgtttccggatgcagaagatgatagaggtgtacagaccagactggtgt
gagaccagggaagactggtccgtcttcctcttctctccccaaaacaagttcaggatgttg
tgccagtccattatagcccataagttgtttgactatgtggtgctggccttcatcttctca
aactgcatcactgtggctctggagagacccaagatccttcagggtagcctggagaggctt
ttcctcaccgtgtccaattacattttcacagccatatttgtgggggagatgacactcaag
gtggtgtctatgggtttgtatattggagagcaggcgtacttgcgcagcagttggaacgtt
ttggatggtttcctggtgtttgtgtctttgattgacattgttgtgtcaatggcgggcggg
gctaagatactgggtgtgctcagggttcttaggcttctgcgcacactgcgccccctcagg
gttatcagtcgagctcctggcctcaaactggttgtggagactttgatcacctctctaaag
cctataggaaacattgttctcatctgctgtgcctttttcatcatctttggcatcctggga
gtccagcttttcaaaggcaagttctactactgcttgggcctggatgtcaaaaacatcacc
aacaagtctgactgcctcttggccaattataagtgggtccatcacaagtacaactttgac
aacttggggcaggccctgatgtccctgtttgtgctggcatcgaaggacggctgggtcaac
attatgtatcatggtctggacgcagtggcagtggaccagcagcccataaccaataacaac
ccctggatgctgctgtacttcatctccttcctcctgatcgtcagtttcttcgtgctgaac
atgtttgttggagtggtggtggagaacttccacaagtgccgacagcaccaggaggtggag
gaggccaagaggagggaggagaagagactgagacgcatggagaaaaagagacggaaggcc
cagaagttgccctactatgccagttacagtcatgtgcgattgatgatccacaccctgtgc
accagtcactacctggacatcttcatcaccttcatcatctgtgtaaacgttgtgactatg
tcactggagcactacagccagcctcgttctctggagatcacactcaagtactgtaattat
ttcttcaccagcacctttgtgctggaggctgtcctgaagctcatcgcgtttggcttccga
cgtttcttcaaagacaggtggaaccagctggatttggctatagtgctgctgtcagtcatg
ggcatcatattggaggagattgagatcagtgcatctctgcccatcaaccccaccatcata
cgtatcatgagggtcctacgcattgcacgtgtgctaaagctgttaaagatggccacggga
atgagagcgctgctggatacggtagttcaagccctgccacaggtggggaatcttggcctc
ctcttcatgctgctgttcttcatttatgctgcactgggggtggaattgtttggagagctg
gtgtgcaacgaggactacccatgtgagggcatgagtcggcacgccacctttgagaacttc
ggcatggcgttcctcaccctcttccaggtctccactggtgacaactggaacggcataatg
aaggacactcttcgagaatgcccgccgggcgaatacacctgtaatcccagcctacaattc
atctctccgatgtactttgtgagctttgtgctcacggcccagtttgttctcatcaatgtg
gtcgtggcagtgctgatgaaacacctagatgactccaacaaagaagcccaggaggaggca
gagatggatgcggagattgaactggagctggcccagggaacgctctgctgcatcggagga
ggcgggtctggagcagagaggagcagtggggggcatcaaggggctggaccctgctctact
cttccacctcactccccgaacacacacccaggtgcccacgagcccaacagcaccaggaaa
ctctactcaccagcccaggagaacttgtggctggacagtgtatcgctgcttatcaaagat
tcatttgaaggggagatgctgatgattgacaacctctctggctccgtcttccatcattac
tcctccccacccatctgcaaggactgcaggactcatccgcaagagcagatccacatggct
gaactggagcaggcatctctgaggtcggagcagctctcagataagtcatcctcaccagcg
ctgcctgatgacctcagcctggacgagcagagcgtgtaccagatgtctgccaaagagggc
aaggaaaggggctgtgatgagtgcctaaacactgaagaacctggagggagaggtcacagc
aggttacggcgaccctctcgggttcacagctctgggacagaagagggggtggcagtgaat
ggagccagttctcaaagtccacatcacaacacacctgctcgtcacagcataggtggagtt
cccagcagtaatcaggaatacccaggggtttctggagcctcaagccgttctaccactccc
atccatctcattgctgaattcttccacccagctgctgcggccctcccggcacccccgaga
ggccgaccgggacacaaaccaagagggctccggctaacttccccagcctcatgggcatct
ctacgctctcctggagcaaacaccaggctgctcaccacacagtattcatctcacagtgac
tcctccctggctacgggcagctcagagagcagcctaccaaccaccatggaagaagggctc
agtttcaccacccagccactgctggacacactccttgacgatcgctccagcctctccaca
aagaccctgagacccagccctccagccgcccagaacctccaaactatgagggggcaccag
cgcagcaagagcagttgtgaaagggacattaatgcaggaagaactcggcaagactccgat
gaggatgtagggatggtacggtgcggttctaaccagacttgcgacagccaacagctctcc
gagacaccgagcagcctgtcgctcacatcgctgcttctgccgagctctctagcgcccccg
tttgtgaaaaagtgcaacagcacaggtagcttagaccaggggattctcacaacccaagaa
aatgtgttcataaaagagccacagggtaaaatcaccagcccctggaaagaaaggaaagaa
ggaagaagagagagtcagtcggaggcagcacaaggaaaagacggggaaagtacaagccaa
ataacaattgtgggctctagaagaaatagatga

DBGET integrated database retrieval system