KEGG   Sinocyclocheilus grahami: 107564159Help
Entry
107564159         CDS       T04918                                 

Definition
(RefSeq) leukotriene B4 receptor 1-like
  KO
K04296  leukotriene B4 receptor 1
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107564159
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:sgh04030]
    107564159
G protein-coupled receptors [BR:sgh04030]
 Rhodopsin family
  Lipid
   Leukotriene
    107564159
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srx 7TM_GPCR_Srsx Serpentine_r_xa 7tm_4
Motif
Other DBs
NCBI-GeneID: 107564159
NCBI-ProteinID: XP_016104654
Position
Unknown
AA seq 387 aa AA seqDB search
MAALVPMKPSALSGPAQTSIAPASPSTASLPLSHQIGIAILVIAFVFGFPGNLFVVWSVL
CRVRRRSITCLLILNLAVADALVLLSAPLFLRYLIGRRGWEFGAALCKTVHYLCCVNMYA
SIYLICLMSMDRWLAVTKPFLSQRLRTKKRLLSVMLGIWVMAFLMALPMPFYRSVLPVST
NVSIYLCKPYHWESNAHEAFQYLIETILGFLLPFSFILFRYISVIRRLRSAMFQRKGRGN
ALILLIIAAFTIFWLPYHLNNILQVIGLMQGSSSSILTVAIVARPNVTAFTFLSSSVNPV
LYVFAGSSHIRQAGLGFMAKLFEGTNSESASTRSSRGSNAESSVFTKLSVKLSRKGDGAR
AETPGGEDENTADVHNRDEMKTLTTLH
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atggccgctcttgttcctatgaagccctcagccctatctggaccagctcagacctccatc
gcgcctgcctccccttccacagcatccctgcccctgtcccatcagatcggcattgctatc
ctggtcatcgccttcgtgtttggttttcccgggaacctgttcgtggtgtggtcggttctg
tgtcgagtgcgtcggcgctccatcacctgtctgctgatcctgaatctggccgtggcagac
gcgctggttctcctgagcgctccgctgttcctccggtacctgataggaaggagaggctgg
gagtttggagcagccctgtgtaagacggtccattacctgtgctgcgtcaacatgtacgcc
tccatctacctgatctgcctgatgagcatggaccgctggctggccgtcacaaagccgttt
ctgtctcagaggttgaggactaagaaaaggctcctgtccgtcatgttggggatctgggtg
atggcttttctgatggctttgcccatgccgttctatcgttccgtcttgccagtctctacg
aatgtgtccatctacctgtgtaagccataccactgggagagcaacgctcatgaagccttt
cagtacctgattgagaccattctgggtttcctgctgcccttcagcttcatcctgttccgc
tacatctcagtgatccgtcggctgcgtagtgccatgttccagcgcaaaggaagaggaaac
gcactcatcctcctcatcatcgctgcgtttaccatcttctggctgccgtatcacctcaac
aacatcctgcaggtgattggtctgatgcagggctcctcctcttctattttaacagtggca
atagtggcgcggcccaacgtgacggcgttcaccttccttagcagcagtgtgaaccccgtc
ctgtacgtgtttgccggcagctctcacatccgtcaggctggtctgggcttcatggccaaa
ctctttgagggaaccaactcggagtcggcctccacccgcagcagtcgcggctctaatgca
gagagctccgttttcaccaagctgtccgtcaagctgagtcgtaaaggggacggggcgaga
gccgagacccctggtggtgaagacgagaacacagcggacgtgcacaacagagatgagatg
aagactctcaccaccctgcattaa

DBGET integrated database retrieval system