KEGG   Sinocyclocheilus grahami: 107564744Help
Entry
107564744         CDS       T04918                                 

Gene name
irak4
Definition
(RefSeq) interleukin-1 receptor-associated kinase 4
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04010  MAPK signaling pathway
sgh04620  Toll-like receptor signaling pathway
sgh04621  NOD-like receptor signaling pathway
sgh05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107564744 (irak4)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107564744 (irak4)
   04621 NOD-like receptor signaling pathway
    107564744 (irak4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107564744 (irak4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sgh01001]
    107564744 (irak4)
Enzymes [BR:sgh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107564744 (irak4)
Protein kinases [BR:sgh01001]
 Serine/threonine kinases: TKL group
  IRAK family
   107564744 (irak4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal Death Kinase-like Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 107564744
NCBI-ProteinID: XP_016105377
Position
Unknown
AA seq 474 aa AA seqDB search
MCDVPRDTPVRKLRFSALRALSDLLDPQHAWRSVATDIRGASGQPRYSQQHIRRFEAVVL
QGKSPTMEMLFDWGTTDCTVGDLVEILLRHQLLAAVSVLLPDHSSCRASAGSSGASLSTL
QCEAAERPSEACLQACVRPEMITKPVSRPVVMEPDSSSGPEENTWSATEEGFYTFTHREL
TVMTSGWDERPVKHGGCLLGAGGFGVVFRGSMCGSTDVAVKKLNPLDDSSLEDLKTQFNQ
EIQTLRSLKHENLVSMVGFSSDGQHLCLVYEFMPGGSLLERLACADGASALSWLSRCCIS
AGAARGLQYLHHNNHIHRDVKSGNILLDEDFVPKISDFGLTRASANHSCSTVMTGRIVGT
TAYMAPEALRGEITPKSDVFSFGVVLLEILSGLPPVDESRDPKLLMEMKDEIDDEELSLE
DFIDGKMQGWRMEEGERMYDVASRCLCEKKNKRPTITEVCVCVRERECDCRRVL
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgacgtgccgcgggacaccccggtccggaagctccggttctcggcgctgagagcc
ctgtcggacctgctggacccgcagcacgcctggaggagcgtcgcgacggacatccgcgga
gcctccggacagccgcgctactcgcagcagcacatccggaggtttgaagcggtggttctg
cagggaaagagtcccacgatggagatgctgttcgactggggaaccacagactgcactgtt
ggagatctggtggagattctgctccgtcaccagctgctcgccgccgtcagcgtcctgctg
cccgatcacagcagctgccgcgcctctgcaggctcctccggcgcgtcgctcagcacactg
cagtgtgaagcagcggagcgtccgtccgaggcgtgtctgcaggcgtgcgtgcgtcctgag
atgatcaccaaacctgtcagcagacccgtggtgatggagccggacagcagctccgggccg
gaggagaacacctggagcgccactgaagaaggtttctacacgttcacgcaccgcgagctg
acggtcatgacgagcggctgggacgagcggcccgtgaagcacggcgggtgtttgctgggc
gccggcggctttggcgtcgtgttcagaggctctatgtgcggcagcacagacgtagctgtg
aaaaaactcaaccctttggacgacagctcacttgaagatctcaagactcagtttaatcaa
gagattcaaacactcaggagtctgaagcatgagaatctggtgagcatggtgggcttctcc
agcgacgggcagcatctgtgtttggtgtatgagttcatgcccggggggtctctgctggag
cggctggcctgtgcagacggggcttcggctctctcgtggctcagcagatgctgcatcagc
gcaggagccgccaggggactgcagtacctgcatcacaacaaccacatccaccgagacgtc
aagagcgggaacatcttattggatgaggacttcgttccgaagatctctgacttcggtttg
acgcgcgcctcagccaatcactcgtgctcgacggtcatgacggggaggattgtgggtacg
acggcctacatggcgccggaggccctgcgaggagaaatcactcctaaatctgacgtcttc
agcttcggcgtggtgttgctggagatcctgtctggtcttcctccggtcgatgaaagccgt
gatcccaaactgctgatggagatgaaggacgagatcgatgacgaggagctctctctggag
gacttcattgatgggaagatgcagggatggcggatggaggagggggagcggatgtatgat
gtggcgtctcggtgtctctgtgagaagaaaaacaaaagacccacgatcacagaggtgtgt
gtgtgtgtgagagagagagagtgtgactgcagacgagtcctctga

DBGET integrated database retrieval system