KEGG   Sinocyclocheilus grahami: 107564850Help
Entry
107564850         CDS       T04918                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: ATP-dependent RNA helicase DHX8-like
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    107564850
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:sgh03041]
    107564850
Enzymes [BR:sgh01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     107564850
Spliceosome [BR:sgh03041]
 Complex C
  Other components
   Step II factors
    107564850
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OB_NTP_bind HA2 S1 Helicase_C AAA_22 T2SSE DEAD AAA_19 AAA_16 ABC_tran PhoH AAA_30 Sigma54_activ_2
Motif
Other DBs
NCBI-GeneID: 107564850
NCBI-ProteinID: XP_016105508
Position
Unknown
AA seq 1078 aa AA seqDB search
MAEIGEDELKKLEYLSLVSKVCTELDNHLGINDKDLAEFVISLAEKHPTIDGFKSVLVKN
GADFSDSLVSNLLRLIQTMRPPAKASTSKGSHPVAKPKNEKDQLKELFPALCRPDNPNTR
TMLDEDDVKVADDAMKELEMFMPSVSGTEPSSSKHRSESSSKKKRRSRSRSRDRDRERDK
DRRRRHRSRSRSRSRSNERDRRKRRSRWHSRSRSRSPARGDRDKGSDRWKDKHVDRPPPE
EPSVGDIYNGKVTSIMQFGCFVQLEGLRKRWEGLVHISELRREGRVANVADVVSKGQRVK
VKVLSFTGSKTSLSMKDVDQDTGEDLNPNRRRNVGGEGQEESAMRNPDRPTNLNLGHAPE
VEDDTLERKRLTKISDPEKWEIKQMIAANVLSKEEFPDFDEETGILPKVDDEEDEDLEIE
LVEEEPPFLRGHTKQSMDMSPVKIVKNPDGSLSQAAMMQSALAKERREVKQAQREAEMDS
IPTGLNKHWVDPLPDTDGRQIAANMRGIGMMPNDIPEWKKHAFGGNKASYGKKTQLSILE
QRESLPIYKLKEQLIQAVHDNQILIVIGETGSGKTTQITQYLAEAGYTTRGKIGCTQPRR
VAAMSVAKRVSEEYGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLIDPDLGQYA
IIMLDEAHERTIHTDVLFGLLKKVRFHKKRRNVVIATNIAETSLTIDGIYYVVDPGFVKQ
KVYNSKTGIDQLXSYPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQR
TNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGSLDDEGLLTRLGRRMAE
FPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFHQPEGDH
LTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVVSCGKATVR
VQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQPEWVVYHELVLTTKEYM
REVTTIDPRWLVEFSPAFFKVSDPTRLSKQKKQQRLEPLYNRYEEPNAWRISRAFRRR
NT seq 3237 nt NT seq  +upstreamnt  +downstreamnt
atggcagagatcggggaagacgagctcaaaaagctcgaatatttgtctttggtgtctaaa
gtttgtaccgaacttgacaaccatttaggaatcaacgataaggaccttgctgagtttgta
atcagtcttgctgagaaacatccaaccattgatggatttaagtcagtcctggtaaaaaat
ggagccgatttctcagattcactcgtcagcaatttgcttcgtctcattcaaaccatgcgt
cctcctgcaaaagcatctaccagtaaaggatctcatcctgtggctaaaccaaagaatgaa
aaggaccagctgaaagagctgtttccagctctgtgcagacctgacaatcctaatactagg
actatgctggatgaggatgatgtgaaagttgctgatgatgccatgaaagagttggagatg
tttatgcctagtgttagtggtacagaacctagcagcagtaaacacagatccgaaagcagc
agtaagaagaagcggaggagcagaagtcggagcagagacagggatagggaaagagacaaa
gacagacggagacgccatcgctctcgctcccgttccagatctcgctccaatgagagagac
agaaggaagcgcaggagccgctggcactctcgcagcaggtccaggagtcctgcacgggga
gaccgagataaaggctccgaccgctggaaggacaaacatgttgaccggcccccaccggag
gagccatctgtgggggatatctacaatggcaaagtcaccagtattatgcagtttggctgc
tttgtgcagttggaaggtctcaggaaacgctgggaaggcttggtccatatttctgagctc
agaagagaaggtcgggtagcaaatgtggcagatgtggtcagcaaaggtcaaagggtcaaa
gtcaaggtgttgtccttcactggatccaaaacaagtctcagtatgaaggacgttgaccag
gacactggtgaagatcttaaccctaacaggaggagaaatgtgggtggagaaggtcaggaa
gagtcggccatgaggaatcctgacagacccactaacctcaacctgggccatgctccagag
gtagaggatgacacattggaacgcaaaagactcaccaagatatccgatccggagaagtgg
gagatcaaacagatgattgctgccaatgtgttgtctaaggaggaattcccagactttgat
gaagagacaggaattctgcctaaagttgatgatgaggaggatgaggacttggagattgag
ctggtggaagaggaacctccattcctgagggggcacaccaaacagagcatggacatgagt
cctgtcaagattgtcaagaaccccgatggatctctctcccaagcagccatgatgcagagt
gccctggccaaagagcgacgggaggtgaaacaggcccagcgggaggctgaaatggactcg
atacccactggccttaacaaacactgggtggacccactgcctgacactgacggcaggcag
atagctgccaacatgaggggcataggtatgatgcccaacgacatcccagaatggaagaaa
cacgcctttggcggcaacaaggcatcctatggcaaaaagactcaactttctattctagag
caaagagagagtcttcctatctacaagctgaaagagcagctcattcaggctgtccatgac
aaccagatcctgattgtgatcggtgagacgggctcagggaagaccactcagatcactcag
tacctggctgaggctggatacaccacacgggggaagatcgggtgcacacaacccagaaga
gtggcagccatgtctgtggctaaaagagtgtcggaggagtacggttgttgtttaggtcaa
gaggttggatacaccatccgttttgaggactgcacaagtcccgagactgtcattaagtac
atgacggacggtatgctgttaagagagtgtctgattgaccctgatctgggccagtatgca
atcattatgttggatgaggcccatgagagaaccattcacacagacgtgctctttggcctg
ctcaagaaggtacgctttcacaaaaagagaagaaatgtggttattgctactaacatcgca
gagacttctttgacaattgatgggatctactatgtggtggatccaggttttgtcaagcag
aaggtttataactccaaaactggcattgatcagctangtagttaccccatttcccaggcc
caggctaagcagcgagcgggcagagcaggtagaacaggccctgggaagtgctacagactc
tacacagaacgtgcctacagagatgagatgctcaccaccaacgtacctgagattcagaga
actaacttggccagcactgtactttctctaaaggcaatgggcatcaatgacctattgtca
tttgatttcatggatgctccgcccatggagacgctcatcacggccatggagcagctgtac
actctaggatcgttggatgatgaaggtttgctcacacgcctcggtcgtagaatggctgag
tttcctctggagcccatgctttgtaagatgttgatcatgtccgtccatcttggctgtagc
gaagagatgctgaccatagtgtcaatgctctcagtacagaatgtcttctatagaccaaag
gacaaacaagctctggcagaccagaagaaggctaagtttcaccagcctgagggggaccac
ctgactttgttggctgtctacaactcctggaagaacaacaagttttccaacccctggtgc
tacgaaaacttcatccaggcgcgatctctccgtcgtgcgcaggatatccgcaaacagatg
ctgggcatcatggatagacacaagctggatgtggtatcatgcggtaaagccacagtacgt
gtacagaaagccatctgcagtggtttcttccgaaatgcagccaaaaaagatcctcaagaa
ggttacaggaccctcatagaccagcaggtggtctacatccacccctctagtgcgttgttc
aatcgccaacctgaatgggtggtgtatcatgagcttgtgctgaccactaaagagtacatg
agggaggtgaccaccattgacccaaggtggcttgtagaattttctccagcattcttcaaa
gtctctgatcccacacgcctcagcaagcagaagaaacagcagcggttggagcccctctac
aaccgctacgaggaaccaaatgcctggagaatatccagagccttcagacgacgctag

DBGET integrated database retrieval system