KEGG   Sinocyclocheilus grahami: 107565123
Entry
107565123         CDS       T04918                                 

Gene name
adamts13
Definition
(RefSeq) A disintegrin and metalloproteinase with thrombospondin motifs 13
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
sgh  Sinocyclocheilus grahami
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sgh01002]
    107565123 (adamts13)
Enzymes [BR:sgh01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     107565123 (adamts13)
Peptidases and inhibitors [BR:sgh01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   107565123 (adamts13)
SSDB
Motif
Pfam: TSP1_ADAMTS TSP_1 Reprolysin ADAM_CR_2 Reprolysin_4 TSP1_spondin Reprolysin_3 TSP1_CCN Reprolysin_5 Reprolysin_2 Peptidase_M10 ADAM_spacer1
Other DBs
NCBI-GeneID: 107565123
NCBI-ProteinID: XP_016105822
Position
Unknown
AA seq 1379 aa
MWTNMGALIWLFLVPSLLKTTALLISQCTLQKDFLESLKPQDLFYYFDTISIKSVPHFEL
VWVNCSGNESFRGLWRCSFHSEEESFELGQHRDEQPVSCPTSLEMVINSTVSVVKKREDM
CCEQLKLLRPAHTRTLLPICHGKLQGLIQSGEKRLYIRPVLQKHIDHLKELTVDLPSGVP
HLLLTYTLPVRTRLKQPKSQFRLRRTPLGSEVTHLELAVVVGPDVYDVHRQDTERYILTN
LNIASELLRDVTLGANIRVHLVRMVILTEPKSDIQISENITSSLKSVCEWGQRVNPDADT
DPIHADLLLYITRFDLVLPNGNKLVRGVTQLGGVCSTQWNCVITEDTGFDLGITMAHEIG
HSFGINHDGIDNTCSSSGFMMASDGGYNSVDLTWSQCSRAQLHNFFSAGKAECVKDVPVL
GGSVQDWRPGLFYGVDDQCRIAFGSSATACSFTNGDMATCRVLSCHINPRDRSSCTRLLV
PLLDGTECGPSQWCLKGRCVAPSTLGSSMMVHGSWSSWSEFSPCSRTCGGGITYRRRQCN
NPRPAFGGTVCKGQDTEAELCNRQSCESTQLEFMSQQCSATDQQPLSVSPESSSVYTWIP
AVGYSSGDAQCKLMCRSREQDFMVSRGSQFIDGTRCEAAHTAPRGSISACLGGKCQLFGC
DGVMHSGKVEDVCGVCGCNGSTCQFISNTYSGGEAGEYVTFLSLPLNASQVHVINTKPVF
THLAVLLNDKYVVSGDGSPGLSITYPSPLEKSPIIYNLYLTPDHLPQTEELTISGPVTDK
IHIQVYRKYGQEYGDLTTPNISYQYYSSEAVSAERAAKGRWSTVISACSVTCGTGMQKIS
QHCMDVLTMERLEDELCSSFPQAPDQLQPCFQTDCPPSWEVGEFGPCSAPCGVGEQGRSV
TCVQKQGTVKVELPDSDCALDSKPRTTETCNPQICPARWQVSEPGECSAVCGPGEAQRTV
SCVRSHHGSDSEVDQNLCYEPKPREHVPCVVDVCPVGWDSQREQIHTDSRVMPRSRMVPV
YVWSPVIGQCSKTCGNGSQQVWFSCVDHQSRLEVPEFLCDRSSKPEMYTQPCSPSKCPAM
WRYIQGPCSVSCGGGVAKRVLYCSQRVEGADGNRDLVVGESACQSVARPSEVVECNTEAC
PARWQAGEQGDCSVSCGMGVAVRSVRCVQYEGGVERVVEEDRCDPGIKPPITAPCFPQVC
SFHWDVHEWSECSVSCGDGIQSRTVSCMGPSSPLPVSPFLCLHLPKPITIQACYSPDCSS
AQTSTLEPNSTRMQSEPWREEGTERTTPAPAVRMMKMRKSFSATAATADVMKSTMSTTTE
PPQTSFCGRLLLQDSGTIDLRNVTQTRCIFAIGRPLDEVIQIKIISSTFNCRQSKYRAH
NT seq 4140 nt   +upstreamnt  +downstreamnt
atgtggacaaacatgggagctctgatctggctctttctggttccaagtttgttaaaaaca
acagctctactgatttcacaatgcactttgcagaaggattttttagagtcactgaaacct
caagatttattttattattttgataccatttccattaaatcagtgcctcactttgagctg
gtgtgggtgaattgctcagggaatgagtctttcagagggctatggaggtgctcgtttcac
agcgaagaagagagttttgagctgggccaacacagagatgaacaacccgtgtcctgtccc
acgagtctggagatggtgatcaactcaacagtgagtgtggtgaagaaaagggaggatatg
tgctgcgaacagctgaagttactgagaccagcacatacgagaactcttctccccatctgc
catggcaaattacaaggtctgattcagtcaggggagaagaggctgtatattcgcccggtg
cttcaaaaacacatagaccatctgaaggagcttactgtggatttaccttctggtgtacct
cacctgctgttgacctacacattaccagtgaggacacgtcttaaacagcctaaaagtcag
ttcaggttgcggcgaacacctctggggtcagaggtcacacatctggagctagcagtggtg
gtgggtccagatgtctatgatgttcataggcaggacactgagagatacatcctaaccaac
ctcaacatcgcctctgagcttctgagagatgtcactctcggcgccaatataagagttcat
cttgttcgtatggtcattctcacagagccgaagtcagacatccagatctctgaaaacatc
acctcctctctaaaaagtgtgtgtgagtggggtcagagggtcaaccctgatgctgacact
gaccctatacatgcagatctactgttatacattaccaggtttgatctggtgttacccaat
ggaaataagcttgtgagaggtgtgacccagctgggtggagtctgttccactcagtggaac
tgtgtgattacagaagataccggctttgatcttggcatcaccatggctcatgagattggc
cacagttttggcataaatcatgatggaatagacaacacatgcagctccagtggctttatg
atggcatctgacggaggttataacagtgtcgatctcacctggtcccagtgcagcagagct
cagctccacaacttcttcagtgctgggaaggcggagtgtgtgaaagatgtgccggtgctg
ggtggatcggtgcaggactggaggcctggtctcttctatggagtggacgatcagtgtcgt
atagcgtttggcagctcggctactgcttgctctttcactaatggtgatatggcaacctgt
cgtgttttgtcgtgccatatcaaccctcgtgaccgcagctcatgcactcgtctccttgtt
ccactcttggacgggacagagtgtgggcccagtcagtggtgtttgaagggccggtgtgtg
gctccttctactttgggttcctccatgatggttcacggctcttggtcttcatggtctgaa
ttctctccctgctcacgaacatgtggaggaggaatcacttaccgcaggagacagtgcaac
aaccccagaccagcctttggtggtaccgtctgtaaaggacaggacaccgaagctgaactt
tgtaatcggcagtcctgtgagtcgactcagctggagttcatgtctcagcagtgctcagcc
acagaccagcagcctctgtcggtgtctccagaatccagctcagtctacacctggatccct
gctgtcggctacagctcaggtgatgctcagtgtaaactgatgtgtcgctcacgtgagcag
gacttcatggtgagtcgtgggtctcagttcatcgatgggacgcggtgtgaagctgctcat
actgcaccacgtggttctatttctgcctgtctgggtggaaagtgccagctttttggctgt
gatggagtaatgcattctgggaaggtggaggatgtgtgtggggtctgtgggtgcaatggc
tccacctgtcagttcatctcaaacacctattcaggtggagaggctggagagtatgtcaca
ttccttagccttcctctgaacgcctctcaggttcatgtgattaacacgaagccggttttt
acacaccttgcggtgttattaaatgataaatatgtggtgtctggagatggaagcccaggc
ctgagcatcacgtacccctcgcctctggagaaaagccccataatctataacctgtacctc
acacctgaccacctgcctcaaaccgaagagctcactatctctgggccggtcacagacaaa
atccacatacaggtgtatcggaaatacgggcaagagtatggagaccttaccaccccaaac
atctcataccagtactattcgtctgaagctgtttcagcggagagagctgctaaaggcaga
tggtccactgtcatctctgcctgctcagtgacctgcggcacaggcatgcagaaaatcagt
cagcactgtatggatgtgctcacaatggagcgtctggaagatgagctctgcagttcattc
ccgcaagcaccagatcagctgcagccctgcttccagaccgactgcccacccagctgggag
gtgggtgagtttggaccctgcagcgccccctgtggcgtgggagagcaggggcgctctgtc
acatgtgttcagaagcagggtacggtgaaagtggagctgcctgactccgactgtgcgctt
gactccaaaccccgaaccactgagacctgcaacccccaaatctgtcctgccagatggcag
gtgtccgagcctggcgagtgttcggctgtgtgtggacccggggaggctcagagaacagtg
tcgtgtgtccgctcccatcatggatctgattctgaggttgaccaaaacctgtgctatgaa
cccaaaccccgagaacacgttccctgtgtggtggacgtttgtcctgtcggctgggattcc
caaagagagcagatccatacagactcccgtgtaatgccccgctccagaatggttccggtt
tatgtttggagtccagtgattggccagtgctcaaagacctgtgggaacggatctcagcag
gtttggttctcctgtgtggatcaccaatcacggctagaagtcccagagttcctttgtgat
cgttccagtaaaccagagatgtacacccagccctgtagcccatcaaagtgtcctgctatg
tggcgctacatacagggcccatgcagtgtgtcttgtggaggtggtgtagcgaagagagtc
ctgtactgttcccagagggtggagggagcagacggaaacagggatctggtggtgggagaa
tctgcttgtcagtctgtggccagaccttcagaggtagtggagtgtaatactgaagcctgt
ccagccaggtggcaggcaggagagcagggcgactgttcggtgtcatgcgggatgggtgta
gctgtcaggagtgtgcggtgtgttcagtatgaaggaggtgtagagagggtcgtggaggag
gaccggtgtgacccaggaatcaagcctcccatcactgcaccatgcttcccacaagtctgt
tcgttccactgggacgtgcatgagtggagtgagtgttcagtctcatgtggtgatgggatc
cagtctcggaccgtgtcctgcatgggcccatccagccctcttcctgtcagtcccttcctt
tgcctccacttacccaaacccatcaccatccaggcctgctatagtcctgactgttcctca
gctcagacctccacactagagcccaacagcactcgcatgcagtcagagccctggagagaa
gaggggacagagagaaccacaccagctccagctgtcagaatgatgaagatgaggaagagt
ttctcagctactgcagctacagcagatgtgatgaaaagcaccatgagcacgacaacagaa
ccaccacagaccagtttctgtgggcgacttctgcttcaagactcaggaactattgatctg
cgcaacgtcactcagacgagatgtatatttgctattggtcgacctcttgatgaggttatt
cagatcaaaatcatatccagcacttttaactgccggcagagtaagtacagagctcactga

DBGET integrated database retrieval system