KEGG   Sinocyclocheilus grahami: 107565169Help
Entry
107565169         CDS       T04918                                 

Definition
(RefSeq) pyruvate carboxylase, mitochondrial-like
  KO
K01958  pyruvate carboxylase [EC:6.4.1.1]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh00020  Citrate cycle (TCA cycle)
sgh00620  Pyruvate metabolism
sgh01100  Metabolic pathways
sgh01200  Carbon metabolism
sgh01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    107565169
   00620 Pyruvate metabolism
    107565169
Enzymes [BR:sgh01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     107565169
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HMGL-like
Motif
Other DBs
NCBI-GeneID: 107565169
NCBI-ProteinID: XP_016105871
Position
Unknown
AA seq 122 aa AA seqDB search
MGFREVLLREGPEGFARAIRQHQGLLLMDTTFRDAHQSLLATRVRTHDLKKIAPFVSHNF
NNLFSLENWGGATFDVALRFLSECPWKRLQELRALIPNVPFQMLLRGANAVGYTNYPDNA
VF
NT seq 368 nt NT seq  +upstreamnt  +downstreamnt
atgggcttccgtgaggtcctgttgagggagggtcctgagggttttgcacgggcaattcga
cagcaccagggtcttctactgatggacactaccttcagagatgcccaccagtccctgctg
gccactcgcgtcaggacacacgacctcaagaagattgctccattcgtgagccacaacttc
aataatctcttcagcctggagaactggggaggagctacatttgatgtagcattgcgtttt
ctgtcggagtgtccgtggaagagacttcaggagctccgagctctgattcccaatgtccca
tttcagatgttgctacgtggagccaatgcggtgggatacacaaactatcctgataatgca
gttttcaa

DBGET integrated database retrieval system