KEGG   Sinocyclocheilus grahami: 107565814Help
Entry
107565814         CDS       T04918                                 

Definition
(RefSeq) mitogen-activated protein kinase kinase kinase kinase 4-like
  KO
K04407  mitogen-activated protein kinase kinase kinase kinase 4 [EC:2.7.11.1]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107565814
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sgh01001]
    107565814
Enzymes [BR:sgh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107565814
Protein kinases [BR:sgh01001]
 Serine/threonine kinases: STE group
  STE20 family
   107565814
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CNH Pkinase Pkinase_Tyr Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 107565814
NCBI-ProteinID: XP_016106579
Position
Unknown
AA seq 1033 aa AA seqDB search
MDVTEDEEEEIKLEINMLKKYSHHRNIATYYGAFIKKSPPGHDDQLWLVMEFCGAGSITD
LVKNTKGNSLKEDWIAYISREILRGLAHLHAHHVIHRDIKGQNVLLTENAEVKLVDFGVS
AQLDRTVGRRNTFIGTPYWMAPEVIACDENPDATYDYRSDLWSCGITAIEMAEGAPPLCD
MHPMRALFLIPRNPPPRLKSKKWSKKFFSFIEGCLVKNYTQRPPTDQLLKHPFIRDQPNE
RQVRIQLKDHLDRCRKKRGEKDETEYEYSGSEEEEEEAQEQEGEPSSIVNVPGESTLRRD
FIRLQQENKERSEALRRQQLLQEQQLREQEEYKRQLLAERQKRIEQQKEQRRRLEEQQRR
EREMRRQQEREQRRREQEEKRRLEEMERRRKEEEERRRAEEEKRRADREQEYIRRQLEEE
QRHLEILQQQLLHEQAMLLVDERHRRSVQGSPQTAVLQKQPPAVPPRSSEPFSNGSSSSD
PQDLTALAKELRAVEDVRPQHKATDYSSSSEDSGTTDDEDDEEVDQEAGEESTSGPEDSR
AGSSRLSNGETEAAKTMVVQDNDASSTPCKDSTLIMRQFQRAGPVTVLGSGWIPSPVEIG
QRNCIRGLPDLLQQSSSAPSSPALSPLSPSDRVPCLAETPTVPKHKSSSSFTPFIDPRLL
QVSPSTGSALNNAGYSNDARLQEALRQDASRKGSVVNVNPVNTRPQNDTPEIRKYKKRFN
SEILCAALWGVNLLVGTESGLMLLDRSGQGKVYPLISRRRFQQMDVLEGLNVLVTISGKK
NKLRVYYLSWLRNKILHNDPEVEKKQGWTTVGDLEGCVHYNVVKYERIKFLVLALKNSVE
VYAWAPKPYHKFMAFKSFGDLVHKPLLVDLTVEEGQRLKVIYGSCSGFHAVDVDSGAVYD
IYLPTHIQSSIQSHAIIILPNTDGIELLVCYEDEGVYVNTYGRITKDVVLQWGEMPTSVA
YIRSNQIMGWGEKAIEIRSVETGHLDGVFMHKRAQRLKFLCERNDKVFFASVRSGGSSQV
YFMTLGRTSLLSW
NT seq 3102 nt NT seq  +upstreamnt  +downstreamnt
atggacgtgactgaagatgaagaagaggagattaagctggagattaacatgctgaagaaa
tactctcatcatagaaacatcgccacgtattacggcgccttcatcaagaagagtcctcca
ggacacgacgaccagctgtggctggtgatggagttttgtggagccggttcgatcacagat
cttgtgaagaacactaaagggaattccctgaaggaagactggatcgcatacatctccaga
gaaatcctcaggggtttggctcacctgcacgctcatcacgtcatccacagagacatcaag
ggccagaacgtgcttctgacggagaatgccgaggtcaagctagtggacttcggcgtcagc
gctcagctggatcgaaccgtgggccgcagaaacaccttcatcgggacgccgtactggatg
gctcccgaggtcatcgcctgcgacgagaacccagacgccacgtacgactacaggagcgac
ctgtggtcctgtgggatcactgccatagagatggccgagggcgctcctccattgtgcgat
atgcatcccatgcgagcgctctttctcatacccagaaatcctccgcccagactcaagtcc
aagaaatggtctaagaagttcttcagcttcatcgagggctgtctggtgaagaactacacg
cagcggccgcccaccgatcagctgctgaagcaccccttcatcagagaccagcccaacgag
cggcaggtgcgcatccagctcaaagaccacctggaccgctgccgcaagaagcgcggagag
aaagacgagaccgagtacgagtacagcggcagtgaggaagaggaggaggaggctcaggag
caggagggagagcccagctctatcgtgaacgtgccgggcgagtcgactctgcggcgggac
ttcatccgtctgcagcaggagaataaggagcgctcggaggccctgagacgccagcagctc
ctccaggagcagcagctccgcgagcaggaggagtacaagcggcagctgctggccgagcga
cagaagcgcatcgagcagcagaaggagcagaggaggcgtctggaggagcaacagagacgc
gagcgcgagatgaggaggcagcaggagcgagagcagaggaggagagagcaggaggagaag
aggcgcctggaggagatggagaggaggcgcaaagaggaggaggagcgccgaagggcagag
gaggagaagaggagggctgaccgcgagcaggagtacatccgccggcagctggaggaggag
cagaggcacctggagatcctgcagcagcagctgcttcacgagcaggccatgctcctggtg
gatgagcgtcaccgcaggagcgtgcagggctctcctcagaccgcagtcctgcagaagcag
cctccagccgtgccaccgcgatcatcagagcccttctccaacggcagcagcagcagtgac
ccgcaggatctgacggcgctggcgaaggagctgcgtgcggtggaggacgtgcggccgcag
cacaaagccacggactactcgtcctccagcgaggactcgggcaccactgatgacgaggac
gacgaggaggtggatcaggaggcgggagaggagtcgacgtctggccccgaggactcccgc
gccggctcgtccagactcagtaatggagagacggaagcagctaagaccatggttgtccaa
gacaacgacgcctcctctacgccatgcaaagacagcacgctgatcatgagacagttccag
agagcagggcctgtgacagtgctgggatcaggctggattcccagtcctgtagagattggg
cagaggaactgcattaggggcctgcccgacctgctccagcagtcctcctcggctcccagc
agccctgccctgtcccccctcagtccctcggacagagtcccgtgcctagcagagactccc
accgtgccgaagcacaagtcttcctcgtctttcacgcccttcattgacccgcgtctcctg
caggtctctccatccaccggcagcgcgctcaataatgctggttacagtaatgacgctcga
ctgcaggaggctctgcggcaggacgcgtctcgtaagggatcggtggtcaacgtcaaccct
gtcaacacacggccccagaacgacacgccagagatccgcaagtacaagaagaggttcaat
tcagagatcttgtgcgctgctctctggggagtgaatctgctggtgggcacagagagcggc
ctcatgctgctggatcgcagcggtcagggcaaggtctacccgctcatcagccgcagacgc
ttccagcagatggacgttctggagggactcaatgtgctggtgaccatatcagggaagaag
aataaattgcgtgtgtactatctgtcctggctgaggaacaagatcctccataatgaccct
gaggtggagaagaagcagggctggaccaccgtaggagaccttgagggctgtgtgcactac
aacgtcgtgaagtacgagaggatcaagttcttggttctggccctgaagaattcagtcgag
gtgtacgcctgggctcccaaaccctaccataagttcatggctttcaagtccttcggtgat
ctggtgcacaagccgctgctggttgacctcacggttgaagaaggccaaaggttaaaggtc
atctacgggtcctgctctggctttcatgccgtggatgtggactcgggagccgtctacgac
atctatctgccgactcacatccagagcagcatccagtcacacgccatcatcatcctgccc
aacacggacggcatcgagctgctggtgtgctacgaggacgagggcgtgtatgtcaacacc
tacggccgcatcactaaagacgtggtgctgcagtggggcgagatgcccacctccgtcgcg
tatatccgctctaaccagatcatgggctggggagagaaggccatagagatccgctcggtg
gaaacgggccacctggatggagttttcatgcacaaaagagcacagcgactcaagtttctg
tgtgagaggaatgacaaggtgttcttcgcctcggtgcgctccggcggctccagtcaggtg
tacttcatgacgctgggacgcacctctctgctcagctggtga

DBGET integrated database retrieval system