KEGG   Sinocyclocheilus grahami: 107566401Help
Entry
107566401         CDS       T04918                                 

Definition
(RefSeq) methionine--tRNA ligase, cytoplasmic-like
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh00450  Selenocompound metabolism
sgh00970  Aminoacyl-tRNA biosynthesis
sgh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    107566401
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    107566401
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sgh01007]
    107566401
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sgh03016]
    107566401
Enzymes [BR:sgh01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     107566401
Amino acid related enzymes [BR:sgh01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   107566401
Transfer RNA biogenesis [BR:sgh03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    107566401
 Prokaryotic type
   Other AARSs
    107566401
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g GST_N_5 WHEP-TRS GST_N_3 GST_C_3 GST_C_2 tRNA-synt_1
Motif
Other DBs
NCBI-GeneID: 107566401
NCBI-ProteinID: XP_016107335
Position
Unknown
AA seq 660 aa AA seqDB search
MKLYIAEGSPQCVKVLAALELTGVQCEVEAVSPEEKVVPLLLLPAGQHLFSPNSICQYLF
DISGQKATDATNEWLEWEATSLQPAVLQSLHMLALQGKRVEAAAVMKEPLKWLEQSLSKK
DSSFLTAEAVSVADVILWAALYPLLSDSSFDVGELRSVRGWFERVGDLAACQAAANRVLQ
GKGVEALKTFLQKHPATQTQRRDSPTNATEGRTTTKQQTEIAQDIFWRLHERGFLLEDTV
AQLRCESCQRFLADRFVEGECPHCRYPEARGDQCDKCGRLINAVELGNPQCKVCKETPVI
RSSKHLFLNLPKLEDELEQWLDKSMSSGDWTVNARHITRSWIRDGLKPRCITRDLQWGTP
VPHEDYKEKVFYVWFDAPIGYLSITANYTDQWEKWWKNPQQVELYNFMAKDNVPFHSVVF
PCSLLGAQDNYTLVNHLIATEYLNYEDTKFSKSRGVGVFGDMAKDTGIPSDVWRFYLLYL
RPEGQDSAFSWSDMALKNNSELLNNLGNFINRIRDALKCILNISRHGNQYMQLNEPWKKI
KGGDGDRRVSPLFQKLENEQIEVLRKRFGGQQAPSSAAETKPSAGAVHDASVNANADPER
AKQLTALVAEQGNKLRGLKAQKADKSVIDDEVEKLLQLKKQLSLAEGKNPEPAAQKGKKK
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgtatatcgccgaggggagcccgcagtgtgttaaagtgctggcggcgctggag
ctgaccggagtgcagtgtgaggtagaagcggtcagccccgaggagaaagtggtccctctc
ctgctgttacccgccggccagcatctcttcagccccaacagcatctgccaatacctgttc
gacatcagcggccagaaggcgactgacgcgactaacgagtggctggaatgggaagcaacg
agtttacagccggcagtgctgcagtctctccacatgttggcgctccagggtaagcgagtc
gaggcggccgctgtgatgaaggagccactgaaatggctggaacagagtctgagcaagaaa
gactcatcgttccttactgcagaggccgtgtcagttgcagatgtcatcctgtgggcggcg
ctgtatcctctcctgtctgactccagttttgacgtcggtgagctgcggtcggtgcgtggc
tggttcgagcgtgtcggcgatctggccgcatgtcaggcggccgctaacagagtcctgcag
ggaaaaggtgttgaagccctgaagactttcctccagaaacacccggccacacaaacacag
cgccgggacagtcccactaatgccactgagggtcgcaccaccactaaacagcagactgag
atcgctcaggacatcttctggcgtctgcatgagcggggttttctgctggaggacacggtc
gcgcagctgcgctgtgaaagctgtcagcgctttctggccgatcgcttcgtggagggcgag
tgccctcactgccgttacccagaagcccgcggggaccagtgtgacaaatgtggccgtctg
atcaacgctgtggagctcgggaatccgcagtgtaaggtgtgcaaggagacgccggtgatc
cgctcgtctaaacacctgtttctgaacctgccgaagctggaggacgagctggagcagtgg
ctcgataagtcgatgagctccggcgactggactgtaaacgcgcggcacatcacacgctcg
tggatccgtgacggcctgaaaccgcgctgcatcacgcgtgacctgcagtgggggacacct
gtgccacacgaggactacaaggagaaggtgttctacgtgtggttcgacgctcctattggc
tacctctccatcactgcaaactacaccgaccaatgggagaaatggtggaagaatcctcag
caggtggagctctataacttcatggcgaaggacaacgttccattccacagtgtagtgttc
ccttgctcacttcttggagctcaagacaactacacactggtgaatcacctcattgctaca
gaatacttgaattacgaggacacgaagttctccaagagtcgcggcgtcggtgtgttcggt
gacatggctaaagacaccgggatcccgtcagacgtctggcgcttctatcttctgtatctg
cggccggaaggacaggactctgctttctcctggagcgacatggctctcaaaaacaactcg
gagctcctcaacaacctcggcaacttcatcaacaggatccgtgacgctctgaagtgcatc
ctcaacatctctcgtcacgggaatcagtacatgcagcttaacgagccctggaagaagatc
aaaggaggagacggtgacaggcgagtcagtcctttgttccaaaagttggagaacgaacag
atcgaggttctgaggaaaaggtttggaggacaacaggctccgagcagcgctgcagagacc
aaacccagcgctggtgcggtgcacgacgcctcggtgaatgccaacgcagatccagagaga
gccaaacagctgacggctttagtggcagaacaaggcaataaactacgaggcctaaaagcc
cagaaagccgacaagtctgttattgacgatgaagtcgagaaattactgcaactgaaaaaa
caactttctctagcggagggcaagaacccggagccggccgctcagaaaggaaagaagaag
taa

DBGET integrated database retrieval system