KEGG   Sinocyclocheilus grahami: 107566893Help
Entry
107566893         CDS       T04918                                 

Definition
(RefSeq) band 3 anion exchange protein-like
  KO
K06573  solute carrier family 4 (anion exchanger), member 1
Organism
sgh  Sinocyclocheilus grahami
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sgh02000]
    107566893
   04147 Exosome [BR:sgh04147]
    107566893
   04090 CD molecules [BR:sgh04090]
    107566893
Transporters [BR:sgh02000]
 Solute carrier family (SLC)
  SLC4: Bicarbonate transporter
   107566893
Exosome [BR:sgh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107566893
CD molecules [BR:sgh04090]
 Proteins
  107566893
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HCO3_cotransp Band_3_cyto
Motif
Other DBs
NCBI-GeneID: 107566893
NCBI-ProteinID: XP_016107944
Position
Unknown
AA seq 917 aa AA seqDB search
MCEFWDREKTVLMMEAVSFEGDNDMSYEDSESSLPSPFTLTPAGHKGSYDLEQMRQQEEK
QHQTFTFSRDLEAARNTNTNAIKRGDAEAYVELNELRGEVWQEMGRWLGYEENLSPATGQ
WSHPHISYLTFKSLIQLRKVMSTGAVLLDVDESSLSSICQKMVEQLLLKKEIRTTDCDAL
VAILQRKRSQLEPTSAPGSADIELQTFSITKQRDTVDRVEASVVLSGVVENLQKPVVAFA
RLRDSVVMEGVLEAPIPVRFVFFHVGPSHSGMDYHESGRAMASLMADWVFTLEAYLATNE
KDLTNAMADFMDCSIVIPPTEIQDESMLKPIINFQKKMLRDRVHPYDTRLMVGGKAPTGP
GKPREDPLARTGYPFGGMVKDIKRRYKGYLSDFTDALDPQVLSAVIFIYFAALSPAITFG
GLLADKTEHMMGVSEMMVSTCVQGIIFCLFAAQPVLVIGFTGPLMVFEEAFFQFCKSNGF
EYIVGRVWVGMWLIIIVVVIVAVEGSFLVRFISRFTQEIFSILISLIFIYETFSKLIRIF
QAHPLILNYDHLNASLEDPFHPIKKVINITEHPDGNITQHHEIIERAYPNTALLSMCLMF
GCFFVALYLRGFKTSTFLPGPIRRMIGDFGVPIAIFFMIAVDIIISDAYTQKLVVPKGLT
VSNPSARGWFISPFGEKKPFPVWMMFACVVPGLLVFILIFLESQITTLIVSKPERKMVKG
SGFHLDLLLLVFLGGVASVFGVPWLSAATVRSVTHANALTVMTKGPRPQIERVLEQRVSG
ILVAVMIGVSILMEPILKMIPMTALFGIFLYMGITSLSGIQLWDRMRLLITPKKHHPPVP
FVTRVPTMRMHLYTLIQVICLAILWAIKSSAFSLALPFVLILTIPLRMFMTGHVFTVMEM
KCLDADDANVKFDDEDD
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgagttctgggacagagagaaaacagtcttgatgatggaagcggtatcatttgaa
ggggacaatgacatgtcctatgaggacagtgagtcatctctaccatctccattcactttg
acccctgcgggacacaaaggcagctatgacttagagcagatgaggcagcaggaagagaag
cagcatcagaccttcaccttctctagagacttagaggctgcccgaaataccaacaccaat
gccatcaagagaggagatgcagaggcatacgttgagttaaacgagctacgtggggaggtg
tggcaggaaatgggacgctggctgggttatgaggagaacttaagccctgccacgggacag
tggagtcatccccacatttcctatctcaccttcaaaagccttattcaactccgcaaggtc
atgagcacaggggcggtgctgctagatgttgatgagagcagcttatcaagcatttgtcag
aagatggtggaacaactcctactcaaaaaagagatccggaccactgactgtgacgctctt
gtggccatactgcaacgcaagcgcagtcagttagagcccacttcggcccctggttcagca
gacatagagctgcaaacattctcaatcaccaaacagcgagacacggttgatcgtgtggag
gcctctgtggttttatcaggtgtggtggagaacctccagaaaccagtggtggcgtttgca
cgtctacgggactcagtggtgatggaaggggttctagaagctccgattcctgttcgtttt
gtcttcttccacgtggggcccagtcacagtggcatggactatcatgagagtggtcgggcc
atggcgtctctgatggctgactgggtgttcactctggaggcttacttggctacaaacgag
aaagatctgaccaatgccatggcagacttcatggactgcagcattgtgatcccacccaca
gaaatccaggacgagagcatgcttaagccaatcatcaactttcagaagaagatgctacga
gatagagtccacccatatgacacccgactcatggttgggggcaaagccccaactggacct
gggaagccacgggaggatccactagcccgtaccggctatccgtttggcggtatggtcaaa
gacataaaacgccgctacaagggttaccttagtgactttaccgatgcactggaccctcag
gtgctgtctgctgtcatcttcatctacttcgctgccctttcacctgccattacctttgga
ggacttcttgcggacaagacggagcacatgatgggggtctctgagatgatggtctctacc
tgtgtgcagggcatcatcttttgtctgtttgcggcacagccagtacttgtcattgggttc
actggtccactgatggtgtttgaggaggcgttctttcagttctgcaagtctaacggcttt
gagtacattgtgggccgtgtctgggtgggcatgtggttgatcatcattgtggtggtgatt
gttgcagtggaagggagtttccttgtccgtttcatctcacgcttcacccaagagatcttc
tccatcctgatctctctcattttcatctatgagaccttttccaagcttatcaggattttc
caagcgcatcctttgattttgaactacgatcacttgaatgcttctttggaagaccccttc
caccctatcaaaaaggttatcaacatcacagagcatcctgatggcaatattactcaacat
catgaaataatagagagggcctatcctaacactgccctgctgtccatgtgccttatgttt
ggctgtttctttgttgcattgtatctccgtgggtttaaaactagcaccttccttcccggt
cctattcgtcgaatgattggagattttggtgtccccatcgccatcttcttcatgattgct
gtggatatcatcatcagcgatgcctacacacagaaactggtggtgccaaaggggctgacc
gtgtccaacccatctgctagaggctggttcatcagcccatttggtgagaagaagccattc
cctgtctggatgatgttcgcctgtgttgttcctggcttgttggtcttcatccttattttc
cttgagtcccagatcactacgctgatcgtgagtaagcctgaaagaaaaatggtcaagggc
tctggtttccatctggacctcctccttttggtgttcttgggaggagttgcctctgtcttc
ggtgtcccctggctcagtgctgctacagtgagatctgtcacccatgccaatgccctgact
gtcatgaccaaaggccccagacctcagattgaacgcgtgttagaacaaagagtcagtggt
attttggtggccgtgatgattggggtctcaattctcatggagcccatcctgaagatgatt
cctatgacggctctgtttggcatctttctctatatgggtatcacttcactgagtggcatc
cagctttgggaccgtatgcgtctgcttattacaccaaaaaagcatcatcctcctgttcca
tttgtcacccgtgtgcccactatgcgtatgcacttgtacactttgatccaagtgatttgt
ttggcgattctgtgggcaatcaaatctagtgcgttttcacttgccctgccctttgtcctg
atcctcacgatcccactgagaatgttcatgaccggtcacgtcttcactgtcatggaaatg
aaatgtctggacgcagatgatgcaaatgtgaaatttgatgatgaggatgactaa

DBGET integrated database retrieval system