KEGG   Sinocyclocheilus grahami: 107568201Help
Entry
107568201         CDS       T04918                                 

Gene name
ppil1
Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase-like 1 isoform X1
  KO
K12733  peptidyl-prolyl cis-trans isomerase-like 1 [EC:5.2.1.8]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    107568201 (ppil1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:sgh03041]
    107568201 (ppil1)
   03110 Chaperones and folding catalysts [BR:sgh03110]
    107568201 (ppil1)
Enzymes [BR:sgh01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     107568201 (ppil1)
Spliceosome [BR:sgh03041]
 Complex B
  Other components
   Prp19-related factors
    107568201 (ppil1)
 Complex C
    107568201 (ppil1)
Chaperones and folding catalysts [BR:sgh03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    107568201 (ppil1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase
Motif
Other DBs
NCBI-GeneID: 107568201
NCBI-ProteinID: XP_016109613
Position
Unknown
AA seq 166 aa AA seqDB search
MSGIPPDSWQPPTVSLDTTMGTIVLELYWNHAPKTCKNFAELGRRGYYNNTKFHRIIKDF
MVQGGDPTGTGRGGASIYGKQFEDELHPELKFTGAGILAMANAGPDTNGSQYFLTLAPTQ
WLDGKHTIFGRICQGIGVLNRIGMVETNSQDRPMDDIKILRVNLPN
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgtctggaattccgccggattcttggcaaccccccacagtatcgctggacacaacgatg
ggaactatcgtgcttgaactgtactggaatcatgcgccaaaaacatgcaagaattttgca
gagttgggcagaagaggatattacaacaacaccaagttccaccgcatcatcaaagacttt
atggttcaaggaggcgatccaacagggacaggtcgtggtggtgcatctatatatggcaag
cagtttgaagacgaattgcatccagagttaaaatttacaggcgctggaattctcgcaatg
gctaatgcagggccagatacaaacggaagccagtatttcctcacgctggctcccacacag
tggctggatgggaaacacactatatttggacggatctgccagggcattggagttcttaat
cgtattggcatggttgaaaccaacagtcaggaccgccctatggatgacataaaaattcta
agagtgaatctacctaactaa

DBGET integrated database retrieval system