KEGG   Sinocyclocheilus grahami: 107569057
Entry
107569057         CDS       T04918                                 

Definition
(RefSeq) AF4/FMR2 family member 3-like
  KO
K15195  AF4/FMR2 family member 3
Organism
sgh  Sinocyclocheilus grahami
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:sgh03021]
    107569057
Transcription machinery [BR:sgh03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     107569057
SSDB
Motif
Pfam: AF-4_C AF-4 AF4_int
Other DBs
NCBI-GeneID: 107569057
NCBI-ProteinID: XP_016110549
Position
Unknown
AA seq 1236 aa
MPTIYGSKGKLASVCFMLHHASQSMTQSWPYQQPPGEGGTQPFLYSHSKEGNHPNSRHRH
VRDGVSMRMPSRPLVAPHKSMLADDLKLSSDEDDKDEGCEQTTSWADNDRLSGQQQHHTH
THVGRVRHSSSGSSGSDPSSEWESDHSQRSRSPSPGTHNRCGTPTQQRTLNCSTETESPP
STQWQLDRWLEKVPKNHQSSDHDPGGGQRRTAKSDCGRGPSPGRYWSRDSESRRDYSPCE
SPVPSPKFDYSPRNSPRPSPEYSPCPSPGISLVPSPVPSVCPSPGDSFQGSRSPSPLHPP
RSPSPSLLITRVPSQGTHPQIQPPQQDSPRHIARPTVASNPAHRPKVRPWVPLDHSADQR
KEFRPKDSRSRDSRSKDSRPGPPQQPPHSEHSSTEKSHKDLTHKLEAINSESTSKQRFNS
PSNPISKHLSKKRPSISPKPQVSHSSTTDHSIEHNHRSNETTGVSIHSSHSKSGHSSNFN
TLKRSDRGPSSKSRDSSRSEINSRSSHSSKTKSFPDTKQSSSKQTSQKSSSPKPKVKLGD
APVPRTGHSQKDPKTRERERELDSRGNAQEATLVQTGKEQRQRRLAEEQVIRRHWVRSSE
EEKDKEDRRTEEGERERKRRRRREQEVEWKAVQPKQRPHTNSQHQAQKEYNGHNLEEQRR
KKRRWSNEDISSGPHVTDTSPSPPLSPPLPTPVIKPTRPSSSSSSSSSSSSSSSSSSSDS
DSESSSPRNVAKVPADSTSNQKTVSKRRLDKQGSGTGAHPHESSLSTPETQGRGRHKLYT
LVPFGRTEKSPTVAHRGLRKLVVRIDLSLLGRVPSADEIIERQSSSSALSTGKEKEKTSM
KHLHHLDQLPGDGRSKRKAENGDAQRENKRNHSRADKLLVSVHNETKETLNKQNGCQDDY
FYSKRPVSPLSPPSGILELSKPSVKAQHAEKYHTPPEKDKDSTVQKTQVQKMQPKVEVEC
VGVSGHLQSLSGLLVPPSNLPLHYRGTVPISDVSHHAEYYMHEAKRLKHRADAMVDKLGK
AVNYVDAALSFMECGKAMEEGPLESKSPYTMYAETVELIRYAMRLKSHAGPGASQEDKQL
AVLCFRCLALLYWQMFRLKKDNALKYSKVLLDYFKSSPKGPHKPPPWNNAGKGTVAPASI
CSVNIMGSHTGSSQSSVISIPHRIHQMTANHLNITNSVLYSYEYWEVADTLAKENKEFFN
YLNTLTGPLTLHSSMAHIVQYTRQGLQWIRISANLS
NT seq 3711 nt   +upstreamnt  +downstreamnt
atgcctaccatttatggaagtaagggaaaacttgcaagtgtttgtttcatgcttcaccac
gcatcccagagcatgacccagtcctggccttaccagcagcccccaggggaagggggcact
cagcctttcctgtactcacactcaaaggagggaaaccatcccaattcacgacacagacat
gtgagggatggtgtctctatgaggatgccttcacgtccactcgtggcccctcataaatcc
atgctcgctgatgatctgaagctcagcagtgacgaagatgacaaggacgagggatgtgag
caaacaacttcctgggctgataatgaccgcttgtcaggccagcagcagcaccacacacac
acgcatgtcggaagagtgagacattcaagctcagggtcttcaggatcagacccctccagt
gagtgggaaagcgatcacagccagcgatcacgcagcccgagcccagggacgcacaaccgg
tgtgggacaccgacccagcagcggaccctaaactgcagcacagagacggagagtccacca
tcgacacagtggcagctggacaggtggcttgagaaagtccctaaaaatcatcagtcatct
gaccacgacccaggtggaggacagcgacggactgcgaaatctgactgtggccgaggacca
tcacctggaagatactggagcagagattctgaatccagacgtgattacagtccatgtgaa
agtccagtcccaagtccaaaatttgactacagccccagaaacagtcctcgtcccagccca
gaatacagtccatgccccagtccaggaattagccttgtgccgagcccagtgccaagtgtg
tgtccaagtccaggagacagcttccaagggagtcgaagtcccagccctttacaccctccc
agaagccccagtccaagtctcttaatcaccagagtacctagccaaggtacacatcctcag
atccagccacctcaacaagatagtcccaggcatattgcacggccaaccgttgcctctaat
ccagcacatcgtcccaaagtaaggccatgggtgcctctggaccacagtgccgaccagaga
aaggagtttagacccaaagactctagatccagagactctcgatccaaagactccagacct
ggtcctccccaacaaccccctcattccgagcacagctcaacagaaaagtcacacaaagat
ctcacacacaagcttgaagccataaactctgaatccacaagcaagcaaaggtttaactca
ccttcgaaccccatttcaaagcatttgtcaaagaaaagaccaagcattagcccaaaacca
caagttagtcactcatctacaactgaccatagtattgaacataatcacagaagcaatgaa
actacaggagtgtcaatccacagttcacactccaaatcaggccattcatctaattttaat
actctaaagaggtccgaccgtggtccctcgtcaaagtccagggactcatcccgaagcgaa
atcaacagtcgatctagtcacagctcgaagactaaatctttcccagatacaaagcagtcc
agctctaaacagacttcccaaaagagttccagcccaaagcccaaggtcaaactaggggac
gccccagtgcccagaaccgggcattcccaaaaagacccaaagaccagagagagagagcga
gagttggacagccgaggtaatgcacaggaagcaaccctggtccagaccggcaaggagcag
agacaaagaagactggcggaggagcaagtaataaggcgccactgggttcggagttctgag
gaagagaaagacaaggaagacaggagaacagaggaaggggaaagagagaggaaacggagg
aggaggagggagcaggaagttgaatggaaggcagtgcagcccaagcaaagacctcacacc
aacagccagcatcaagctcaaaaggaatacaatggacacaaccttgaggagcagaggagg
aagaagagaaggtggagcaatgaggacatttcctcaggtcctcatgtgactgacactagc
ccttctcctccactttctccacctttgcctactcctgtcatcaagcccactcgcccatca
tcttcttcgtcctcatcctcctcatcatcctcttcatcctcatcatcttcctctgattca
gactctgagtctagttcaccccggaatgttgccaaagtccctgcagattcaacatcaaac
caaaaaactgtgtcaaaaaggaggcttgacaaacagggttctggcactggtgctcacccc
catgagtcgagcttaagcacacctgagacacaaggtcggggcagacacaaactctacaca
ttggtgccttttggccgtactgaaaagtcccccactgttgcacatcgaggcctgagaaaa
cttgtagtgaggatagacctctcgcttctgggtagagtccccagtgcagatgagattatc
gagagacagtcctcgtcttcagctttgtcaacgggaaaggaaaaagaaaagacatcgatg
aaacacttgcaccacttggaccaactgcctggagatggcagaagtaaaagaaaagctgaa
aatggagatgctcaaagagagaataagagaaatcactctcgtgcagataaactactggtg
tctgtccacaatgagactaaggaaaccctcaacaagcaaaatggatgtcaggatgattac
ttttattccaagaggcctgtatccccattgtctcctccatctggcatactagagctctca
aaaccctcagtaaaagctcagcatgcagagaagtaccacacacctccagaaaaagacaaa
gattcaacagtacagaaaacacaggttcagaagatgcagcccaaggtagaggtggagtgt
gtcggggtgtcaggacacctccagtcactctctggattgctggttcctccctcaaacctt
ccgcttcactacagaggaactgtacctattagtgatgtttctcatcatgctgagtactac
atgcatgaggccaagaggttaaaacatcgagcagatgctatggtggataagctaggaaaa
gctgtgaattatgtggatgctgctttgtccttcatggagtgcggtaaagccatggaagag
ggaccgctggagtccaagtccccctacaccatgtatgctgaaactgtggagctcataaga
tacgctatgagacttaagagtcacgctggccccggagccagccaggaagacaaacagcta
gctgtactatgtttccgctgtcttgctcttctttactggcaaatgttcagacttaaaaag
gacaatgctctaaaatactccaaagtcctgctggactacttcaagagctctccaaaagga
cctcacaaaccccctccttggaacaatgctggaaagggaactgtagctcctgcctctatt
tgctctgtcaatataatgggatctcacacaggcagctcacagagcagtgtcatcagcatt
ccccatcgcatccaccagatgacagcaaatcacctcaacattaccaacagtgtcctgtac
agttatgagtactgggaggtggctgataccctggccaaagaaaataaagaatttttcaac
tatctgaacacactgacagggcccttgactctacatagcagcatggcccatatcgtccag
tacaccaggcaagggctgcagtggatccggatcagtgctaatctatcataa

DBGET integrated database retrieval system