KEGG   Sinocyclocheilus grahami: 107569293Help
Entry
107569293         CDS       T04918                                 

Definition
(RefSeq) 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase-like
  KO
K00070  3beta-hydroxy-Delta5-steroid dehydrogenase / steroid Delta-isomerase [EC:1.1.1.145 5.3.3.1]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh00140  Steroid hormone biosynthesis
sgh01100  Metabolic pathways
Module
sgh_M00107  Steroid hormone biosynthesis, cholesterol => prognenolone => progesterone
sgh_M00110  C19/C18-Steroid hormone biosynthesis, pregnenolone => androstenedione => estrone
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    107569293
Enzymes [BR:sgh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.145  3beta-hydroxy-Delta5-steroid dehydrogenase
     107569293
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.1  steroid Delta-isomerase
     107569293
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 3Beta_HSD Epimerase NAD_binding_4 Polysacc_synt_2 GDP_Man_Dehyd NAD_binding_10 NmrA KR RmlD_sub_bind
Motif
Other DBs
NCBI-GeneID: 107569293
NCBI-ProteinID: XP_016110834
Position
Unknown
AA seq 369 aa AA seqDB search
MTLSGDVCVVTGACGFLGEKLVRLLLEEEKLSEIRLLDRNIQSELILSLDDCKGETKVSV
FEGDIRDCELLRRACKGAALVFHTVSLIDVIGAVEYSELYGVNVKGTQLLLETCIQENVA
SFIYTSSIEVAGPNPHGDPIINGDEDTPYSSCLKFSYSKTKQEAEQICLQANGELLRNGN
HLATCALRPMYIYGPGCRFTLGHMRDGLRNGNVLLRTSRREAKVNPVYVGNAALAHMQAG
RALKDSQKRAVVAGNFYYISDDTPPVSYSDFYYAVLSPLGFGIQERPILPFSLLYLLSFL
MELLHIVLRPFLKFTPPLNGQLLTMLNTPFSFSYQQAHRDFGYSPRYDWEEARKCTSDWL
ASVLPTERQ
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgactctgtcaggagatgtgtgtgttgtgacaggagcctgcgggtttctgggagaaaag
ctggtcaggctgttgctggaagaggagaagctttctgagatccgactgctggatagaaac
atccagtctgagctaatactgtctcttgatgattgcaagggagaaactaaagtgagtgtt
tttgagggggatatcagggactgtgagctactgagaagagcctgtaaaggagcagcactt
gttttccacactgtatctctcatcgatgtcattggagcagttgaatacagtgaattatat
ggagttaatgtcaaaggaacacagctgctgctcgagacctgcatccaagaaaacgtggcc
tccttcatttacactagcagcattgaggtggctggtcccaatccccacggtgatccaata
attaatggcgatgaggacaccccttactcctcctgtcttaagtttagctacagcaaaacc
aagcaggaggctgaacagatttgccttcaggccaatggagagctgctccgtaatggaaat
catctggctacctgtgcactgaggcccatgtacatctatggaccaggctgtcgatttact
ttaggccacatgagggatggactccgcaatggaaatgtgctgctgagaacatcacgacgt
gaggcgaaagtgaatcctgtatatgtgggaaacgcagccctggcacatatgcaagcaggt
cgggctctcaaagattcccagaaaagggctgtggtggctggaaacttctattacatctca
gacgacacgcctcctgtaagctactcagacttttactatgctgttctttcaccattaggc
tttgggatacaagagcggcccattctgcccttctcacttctgtatcttctgtcgttcctc
atggaattactgcacattgtgctccgacccttcctgaagttcactcctcccttaaacggg
cagctactgaccatgttaaacacaccctttagtttctcgtatcaacaggcccacagggat
tttggatatagccctcgctatgactgggaagaggcacgtaagtgcaccagtgactggtta
gcatctgtcttacccacagagagacaatga

DBGET integrated database retrieval system