KEGG   Sinocyclocheilus grahami: 107569464Help
Entry
107569464         CDS       T04918                                 

Definition
(RefSeq) myotubularin-related protein 14-like isoform X1
  KO
K18086  myotubularin-related protein 14 [EC:3.1.3.64 3.1.3.95]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh00562  Inositol phosphate metabolism
sgh01100  Metabolic pathways
sgh04070  Phosphatidylinositol signaling system
sgh04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    107569464
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    107569464
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107569464
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sgh01009]
    107569464
Enzymes [BR:sgh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.64  phosphatidylinositol-3-phosphatase
     107569464
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     107569464
Protein phosphatases and associated proteins [BR:sgh01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    107569464
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myotub-related Y_phosphatase3 Y_phosphatase Y_phosphatase2
Motif
Other DBs
NCBI-GeneID: 107569464
NCBI-ProteinID: XP_016111049
Position
Unknown
AA seq 628 aa AA seqDB search
MASRSEEITELLDVFSKSQYRAREVTPSVERIEERCLELFDRDYKYSIIHNTNGEVCGHY
PRKIVFLEYESSDNNKESFESTVQISKLQDLVNRSKMARCRGRFVCPVILYNGKHVCRSS
TLAGWGELYGRTGYNYIFSGGSDDTFGDAEEVPEDDCAVRNNDSQLFDKVRGSDIKLLKY
LSVCYICDLMVENKKVKFGLNVTSSEKVDKAHRYADFTLLSVPYPGCEFFREYKDRDYTA
EGLVFNWNQDYVDAPLTIPDFFTRNLNIKWSEYQSWDLVQQTQNYLKLLLHIINSDDENG
LLVHCISGWDRTPLFVSLLRLSLWADRAIHASLEPSEILYLTIAYDWFLFGHMLPDRLSK
GEEIFFFCFNFLKHIVCDTFSVIKKQRRKNSQFKDADFTVDDLCQLKSRDRGSVTSLSSD
FSLITEDTSVPSSLHAEATDLTTSGPQASNGRKGMPLSSHSVHGNRPLASEERMPNIITE
ASPLGSFKSSSSSSSNHSDQNVTRTGSTPLAVPGRRPRVEYARSGSSLSTDYGSWQIVSG
CGSIHDLPPVPSESPLPFSFQDEGPSGRMCTFVPDRQVRLEAVRELFLAAYSSTVGLKSS
SPSSSGAISGLLEQFARGVGLRGTNAII
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atggctagccggagcgaggagattaccgaactgctcgatgtgttttcaaagagtcagtac
agagcaagggaggtcaccccgtcggtagagagaatagaggagcgctgtttggagctgttt
gaccgggactacaagtacagtatcatccacaacaccaatggggaggtgtgtggtcactac
ccacggaagattgtgtttctggaatatgaatcttcagacaacaataaagagagctttgag
agtactgtgcagatcagtaaattgcaggatctggtgaaccgtagtaagatggctcgctgt
agagggagatttgtctgtccagtcatcctctacaatggaaagcatgtgtgtcgatcatcc
actctagcaggttggggcgaactttatggacgcactggatacaactatattttttcaggg
ggttcagatgacacctttggtgatgctgaagaggttccggaggatgactgtgcagttcgg
aataatgattcacagttgtttgataaggttaggggctctgacattaagctgttgaagtac
ttgtctgtatgctacatctgtgacctcatggtagagaataagaaggtcaagtttggcctc
aatgtgacttcctcagaaaaggtggacaaggcccaccgttatgctgactttaccctactc
tctgtgccttatccaggatgtgaattcttcagggaatataaagacagagattacacagca
gaagggcttgtcttcaactggaatcaggactatgtggatgctcctttgacaatccctgat
ttctttacaagaaacctcaacatcaaatggagtgaatatcagtcatgggacctggtgcag
cagactcagaactacctgaaactgcttttacacatcatcaactctgatgatgagaacggt
ttactggtgcactgtatatcaggctgggacaggacacctctctttgtatccctgctcaga
ctttcgttgtgggcggaccgtgccattcatgccagtctagagccgtctgagatcctttac
ctgactatcgcatatgactggtttctttttggtcacatgttgcctgatcggctctctaag
ggggaggagattttctttttctgcttcaattttctgaagcatattgtttgtgacacattt
tcagtcataaaaaaacaaagaagaaaaaattctcagttcaaagatgctgacttcacagtt
gatgacctctgccaattaaagtccagagatcggggtagtgtgacgagtttgagcagtgat
ttctctctcatcacagaagatacatctgttccctccagtctacatgcagaagccacagac
ttgactaccagtggaccacaggcttctaatgggaggaaaggcatgccgttgtcttctcat
tctgtgcatgggaaccgaccgcttgcttcagaggagcgaatgcctaatataatcactgag
gccagtcctctggggtcttttaagtcctcaagctcctcctcatccaaccactcagatcaa
aatgttacacggacaggaagtaccccattagctgtaccaggaaggaggccaagagtggaa
tatgctcggtcaggctcctcgctgtccacagattatggcagttggcagattgtctcagga
tgtgggagcatccatgatcttcccccagtgccctcagagtctcctctgccattcagcttc
caggatgagggtcccagcggacgaatgtgcacatttgtacctgacaggcaagtgaggttg
gaggcagtgagggaattgttccttgcagcctatagctctacagtaggactcaagtcatcg
tctccaagctcctccggtgccatctcaggcctgctggagcagtttgcccgtggggtcggc
cttcgtggcactaatgccattatctga

DBGET integrated database retrieval system