KEGG   Sinocyclocheilus grahami: 107570535Help
Entry
107570535         CDS       T04918                                 

Definition
(RefSeq) activin receptor type-1-like isoform X1
  KO
K04675  activin receptor type-1 [EC:2.7.11.30]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04060  Cytokine-cytokine receptor interaction
sgh04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    107570535
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107570535
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sgh01001]
    107570535
Enzymes [BR:sgh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     107570535
Protein kinases [BR:sgh01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   107570535
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase TGF_beta_GS APH Haspin_kinase TMEM154 FTA2
Motif
Other DBs
NCBI-GeneID: 107570535
NCBI-ProteinID: XP_016112253
Position
Unknown
AA seq 548 aa AA seqDB search
MPCKCQIIEGWCKGAWDIYIRLNGRSWKCFFVSNCSLLSSIPSFLDTKASEMLAVLFVLV
YSRSYATLADHVLTDSPPENDEGEEGVLQCSCENTYACVNNTCWGPICFYSSVHERVVRG
CFPTNEQCHVPDVPGLYAKCCFTHLCNANLIVPEKTVEKPIRVILLVGVPLLVLLVLSMA
ACGLVLWLRTRRQHHQLVEHDTSMLKVPSGGDPTYGDIFDEFCTSGSGTGLPYLVQRTMA
RQISLVECVGKGRYGEVWRGTWMGESVAVKIFSSRDEQSWFRETEIYNTVQLRHENILGF
IASDMTSKNSSTQLWLVTHFHELGSLYDFLKYSTLDPEGCLRMCLSIASGLVHLHTEIHS
TQGKPAIAHRDLKSRNILVKRNGQCCIADLGLAVIHSQSNDYLDVGNNLRVGTKRYMAPE
VLDESIRVDVFESYKQTDIWALGLVLWEITRRTIVNGIVEEYRPPFFDVVPSDPSFEEMK
KVVCVDQYRPSLHNRLHSHPILSAVTKIMKECWFQSPSARLTALRVRKTLSKLDQDHDYD
IDKLKLDL
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgccttgtaaatgccagatcatcgaaggatggtgcaagggagcatgggatatatacata
agattaaatggaaggagctggaagtgtttttttgtgtcgaattgctcgctcttatcctct
attccctctttcttagacacgaaggcttctgagatgctcgctgtactgtttgttttggtg
tattcaaggagttacgcaactctcgcagatcacgttttgacggactctcccccagaaaat
gatgaaggcgaggagggtgttttacagtgcagctgtgagaacacatatgcctgtgtaaac
aacacctgctggggccctatttgcttctacagttcggtccatgagcgggtagtcaggggc
tgttttcccaccaacgagcagtgccatgtgcctgatgtacccggattgtatgccaagtgc
tgcttcacacacctctgcaatgcaaacctcattgtgcctgaaaaaacagtggaaaagccc
atcagagtgattcttctggtgggagtgccgttgttggtgctgctggtgttgtcgatggca
gcctgtgggctcgtgttgtggctgcgtacgaggcgacagcaccaccagctggtggaacac
gacacttccatgctcaaagtccccagtggaggggacccaacatatggtgatatatttgat
gagttttgtacgtcaggcagtgggaccggcctgccttatctggtgcagaggaccatggcg
cgacagatctctctggttgagtgtgttggtaaagggcgttatggagaggtatggagaggc
acctggatgggagagagtgtggctgtcaaaattttctcctctcgtgatgaacagtcctgg
tttagagagactgaaatctacaacacagtccaactaaggcatgaaaacattttgggcttc
atagcatcagacatgacgtctaaaaactccagcactcagctgtggctggtcacacacttc
catgagttgggctccctttatgacttcctgaagtacagcacgctggaccccgagggctgc
ctgcgcatgtgcctgtctatcgccagcggccttgtgcacctccacactgagatccacagt
acgcagggcaaaccggccattgcacaccgagacctgaagagccgcaacattctggtgaag
agaaatgggcagtgctgcatcgcagacctgggcctggctgtcattcactctcaatctaat
gattatctggatgtgggcaacaacctgagggtgggaaccaagcgttatatggcaccggag
gttttggacgagagtattcgtgttgacgtttttgagtcttataaacaaactgacatctgg
gccctaggtctcgtcttgtgggagataactcgtcgaactattgtaaatggcattgtggag
gagtacagaccgccgttctttgatgtggtgccctctgaccccagtttcgaggagatgaag
aaagtggtgtgtgtggaccaatacaggcccagtctccacaatcgactacactctcatccg
atcctgtctgcagttacgaagattatgaaagagtgctggttccaaagcccttcagctcga
ctcactgctctgcgtgtgcgaaagaccctctccaaactggaccaagaccatgactacgac
atcgacaagctcaaactggacctctag

DBGET integrated database retrieval system